Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	928
Gene name	CD9 molecule
Gene symbol	CD9
Synonyms (NCBI Gene)	BTCC-1DRAP-27MIC3MRP-1TSPAN-29TSPAN29
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded p

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018296	hsa-miR-335-5p	Microarray	18185580
MIRT019530	hsa-miR-326	Western blot;qRT-PCR	19883630
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT876425	hsa-miR-3149	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT876437	hsa-miR-4775	CLIP-seq
MIRT876438	hsa-miR-4795-3p	CLIP-seq
MIRT876439	hsa-miR-511	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876447	hsa-miR-548u	CLIP-seq
MIRT876448	hsa-miR-561	CLIP-seq
MIRT876449	hsa-miR-590-3p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT1556156	hsa-miR-410	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT1556157	hsa-miR-4720-3p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT1556158	hsa-miR-4804-3p	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT1556159	hsa-miR-889	CLIP-seq
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT1959730	hsa-miR-142-5p	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT1959731	hsa-miR-4803	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT1959732	hsa-miR-548a-5p	CLIP-seq
MIRT1959733	hsa-miR-548ab	CLIP-seq
MIRT1959734	hsa-miR-548ak	CLIP-seq
MIRT1959735	hsa-miR-548b-5p	CLIP-seq
MIRT1959736	hsa-miR-548c-5p	CLIP-seq
MIRT1959737	hsa-miR-548d-5p	CLIP-seq
MIRT1959738	hsa-miR-548h	CLIP-seq
MIRT1959739	hsa-miR-548i	CLIP-seq
MIRT1959740	hsa-miR-548j	CLIP-seq
MIRT1959741	hsa-miR-548k	CLIP-seq
MIRT1959742	hsa-miR-548l	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT876447	hsa-miR-548u	CLIP-seq
MIRT1959743	hsa-miR-548w	CLIP-seq
MIRT1959744	hsa-miR-548y	CLIP-seq
MIRT1959745	hsa-miR-559	CLIP-seq
MIRT2196782	hsa-miR-1224-3p	CLIP-seq
MIRT2196783	hsa-miR-1260	CLIP-seq
MIRT2196784	hsa-miR-1260b	CLIP-seq
MIRT2196785	hsa-miR-1266	CLIP-seq
MIRT2196786	hsa-miR-1280	CLIP-seq
MIRT876424	hsa-miR-1286	CLIP-seq
MIRT1959730	hsa-miR-142-5p	CLIP-seq
MIRT2196787	hsa-miR-3074-5p	CLIP-seq
MIRT2196788	hsa-miR-3124-3p	CLIP-seq
MIRT876425	hsa-miR-3149	CLIP-seq
MIRT876426	hsa-miR-3167	CLIP-seq
MIRT876428	hsa-miR-338-5p	CLIP-seq
MIRT876429	hsa-miR-3655	CLIP-seq
MIRT2196789	hsa-miR-370	CLIP-seq
MIRT876430	hsa-miR-3908	CLIP-seq
MIRT876431	hsa-miR-3924	CLIP-seq
MIRT876432	hsa-miR-3942-5p	CLIP-seq
MIRT1556156	hsa-miR-410	CLIP-seq
MIRT2196790	hsa-miR-4270	CLIP-seq
MIRT876433	hsa-miR-4317	CLIP-seq
MIRT2196791	hsa-miR-4441	CLIP-seq
MIRT2196792	hsa-miR-4518	CLIP-seq
MIRT2196793	hsa-miR-4668-3p	CLIP-seq
MIRT876434	hsa-miR-4703-5p	CLIP-seq
MIRT1556157	hsa-miR-4720-3p	CLIP-seq
MIRT876435	hsa-miR-4722-5p	CLIP-seq
MIRT876436	hsa-miR-4766-3p	CLIP-seq
MIRT1959731	hsa-miR-4803	CLIP-seq
MIRT1556158	hsa-miR-4804-3p	CLIP-seq
MIRT876440	hsa-miR-518d-5p	CLIP-seq
MIRT876441	hsa-miR-519b-5p	CLIP-seq
MIRT876442	hsa-miR-519c-5p	CLIP-seq
MIRT876443	hsa-miR-520c-5p	CLIP-seq
MIRT876444	hsa-miR-526a	CLIP-seq
MIRT876445	hsa-miR-544	CLIP-seq
MIRT1959732	hsa-miR-548a-5p	CLIP-seq
MIRT1959733	hsa-miR-548ab	CLIP-seq
MIRT1959734	hsa-miR-548ak	CLIP-seq
MIRT1959735	hsa-miR-548b-5p	CLIP-seq
MIRT2196794	hsa-miR-548c-3p	CLIP-seq
MIRT1959736	hsa-miR-548c-5p	CLIP-seq
MIRT1959737	hsa-miR-548d-5p	CLIP-seq
MIRT1959738	hsa-miR-548h	CLIP-seq
MIRT1959739	hsa-miR-548i	CLIP-seq
MIRT1959740	hsa-miR-548j	CLIP-seq
MIRT1959741	hsa-miR-548k	CLIP-seq
MIRT1959742	hsa-miR-548l	CLIP-seq
MIRT876446	hsa-miR-548p	CLIP-seq
MIRT1959743	hsa-miR-548w	CLIP-seq
MIRT1959744	hsa-miR-548y	CLIP-seq
MIRT2196795	hsa-miR-555	CLIP-seq
MIRT1959745	hsa-miR-559	CLIP-seq
MIRT876448	hsa-miR-561	CLIP-seq
MIRT2196796	hsa-miR-605	CLIP-seq
MIRT2196797	hsa-miR-767-3p	CLIP-seq
MIRT876450	hsa-miR-876-5p	CLIP-seq
MIRT1556159	hsa-miR-889	CLIP-seq
MIRT876423	hsa-miR-1283	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq
MIRT876427	hsa-miR-330-3p	CLIP-seq

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IDA	12796480, 27993971
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	11278880, 11504738, 12796480, 15344881, 18541721, 23091066, 23289620, 23858057, 26686862, 30833792, 32296183, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	2037603, 6198179
GO:0005886	Component	Plasma membrane	TAS	1840589
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IDA	7511626
GO:0007155	Process	Cell adhesion	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IDA	14575715
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008347	Process	Glial cell migration	IMP	26224160
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	IEA
GO:0014905	Process	Myoblast fusion involved in skeletal muscle regeneration	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030168	Process	Platelet activation	NAS	2037603
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030913	Process	Paranodal junction assembly	IEA
GO:0030913	Process	Paranodal junction assembly	ISS
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0032991	Component	Protein-containing complex	IDA	15344881
GO:0035036	Process	Sperm-egg recognition	IEA
GO:0035036	Process	Sperm-egg recognition	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070062	Component	Extracellular exosome	IDA	15326289, 15908444
GO:0070062	Component	Extracellular exosome	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0090331	Process	Negative regulation of platelet aggregation	IDA	18541721
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1905521	Process	Regulation of macrophage migration	IEA

MIM	HGNC	e!Ensembl
143030	1709	ENSG00000010278

P21926

Protein name

CD9 antigen (5H9 antigen) (Cell growth-inhibiting gene 2 protein) (Leukocyte antigen MIC3) (Motility-related protein) (MRP-1) (Tetraspanin-29) (Tspan-29) (p24) (CD antigen CD9)

Protein function

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion (PubMed:14575715, PubMed:18541721, PubMed:8478605). Present at the cell su

PDB

6K4J , 6RLO , 6RLR , 6Z1V , 6Z20

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	10 → 220	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in platelets (at protein level) (PubMed:19640571). Expressed by a variety of hematopoietic and epithelial cells (PubMed:19640571). {ECO:0000269|PubMed:19640571}.

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE
VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKS
CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Sequence length

228

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Hematopoietic cell lineage		Platelet degranulation Acrosome Reaction and Sperm:Oocyte Membrane Binding Uptake and function of diphtheria toxin

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (152)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23378758, 8521390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30941955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	8478605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	24030729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	6090008, 6331549		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26606261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36826611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	23174138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	9396739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	39212542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	19459130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	17178667, 31399060, 32278313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16103120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	12406906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	1840589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	1537894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19604240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12966509, 14607338, 16047355, 16132579, 1720807, 7664290, 8521390, 9736046		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22791584, 25103498, 9736046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29462126	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9737661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35563166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12966509, 15548710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	17970049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22577054, 38287800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32350244	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	20118909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17308116, 8521390, 8620488, 9508191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35622458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32245320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15380042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10065873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15289859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11802216, 15517878, 25301083, 7797233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	24836286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30941955, 31504073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12838318, 22895844, 25301083, 32589377, 36172359	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	24836286		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	24201754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	7664290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	CTD_human_DG	16168501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11505398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	33218198, 35012489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10098753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26045817	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	26396155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	31341160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21244575, 24133347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	CTD_human_DG	16168501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	26573230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	31680442	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19019175, 26224160, 26573230		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	26573230		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	37938214	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	19019175, 26224160, 26573230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	26573230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22577054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30678441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	11679941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31407387, 34907783	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34181359	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10555209, 11114129, 12925157, 1883515, 2170147, 22090105, 28222792, 8083609, 8857018, 9820572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	16171885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11679941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23886139		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10848783, 27035504, 8478605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17852453, 24699135, 30740913, 7657811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12717686, 29720577, 30740913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25045197, 9734655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15739024, 17072745, 24030729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	6090008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27081035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	26396155		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	9117038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32245320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624, 21436623, 39212542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10098753, 24006899, 35563166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20060356	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26045817, 30794730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	9920853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28963391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12966509, 14607338, 16132579, 7664290, 9736046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17308116, 8521390, 8620488, 9508191, 9552043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29416746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15756676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17308116, 17593626, 22353810, 24006899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11802216, 15517878, 25301083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12579280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11739177, 24412090, 34012515, 35563166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16523488, 19777564, 8478605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35563166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26315299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	20118909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23128478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23128478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34012515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16324750, 9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	32366041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10891455, 15289859, 15739024, 8478605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10891455, 24788635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16900214, 18483358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12406906, 27035504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12966509, 15170671, 15352042, 19019175, 28138030, 6090008, 7664290, 8174106, 9736046, 9761121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Embryonal and Mixed	Neoplasm	CTD_human_DG	16168501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	CTD_human_DG	16168501		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	28577929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11172599, 12072202, 26653549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32319615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17043644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17593626, 8521390, 9508191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39778696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30678441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	11679941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16215274, 35622458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36671463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33276480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	15820804	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	19604240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29416746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17406028		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17848953, 26036626, 32319557, 33569050	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	16324750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32245320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	8174106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37603355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2692124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17223013, 9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	17970049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	12569360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16491954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	1537894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	14735195, 23886139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20060356	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12966509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	31191307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15756676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12174360, 21521534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15047125, 15476162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17167184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	17178667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	8080982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27179277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	14534881, 16103120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	15161643, 23486877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23128478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD9 (CD9 molecule)