Gene Gene information from NCBI Gene database.
Entrez ID 9275
Gene name BAF chromatin remodeling complex subunit BCL7B
Gene symbol BCL7B
Synonyms (NCBI Gene)
SMARCJ2
Chromosome 7
Chromosome location 7q11.23
Summary This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene kn
miRNA miRNA information provided by mirtarbase database.
586
miRTarBase ID miRNA Experiments Reference
MIRT046246 hsa-miR-23b-3p CLASH 23622248
MIRT038593 hsa-miR-106b-3p CLASH 23622248
MIRT462373 hsa-miR-320a PAR-CLIP 23592263
MIRT462372 hsa-miR-320b PAR-CLIP 23592263
MIRT462371 hsa-miR-320c PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000, 29374058
GO:0003779 Function Actin binding NAS 8605326
GO:0005515 Function Protein binding IPI 21044950, 25416956, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0006338 Process Chromatin remodeling NAS 10078207, 29374058
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605846 1005 ENSG00000106635
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQE9
Protein name B-cell CLL/lymphoma 7 protein family member B (allergen Hom s 3)
Protein function Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1 (PubMed:25569233). Involved in cell cycle progression, maintenance of the nuclear struc
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9860302, ECO:0000269|PubMed:9931421}.
Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKS
KSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSES
LSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDS
GAPPLKRFCVDQPTVPQTASES
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 14647414
★☆☆☆☆
Found in Text Mining only
Arthritis, Gouty Gouty arthritis GWASDB_DG 23263486
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 18670637 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 34362400 Associate
★☆☆☆☆
Found in Text Mining only
Gout Gout GWASDB_DG 23263486
★☆☆☆☆
Found in Text Mining only
Leiomyosarcoma Leiomyosarcoma Pubtator 34260555 Associate
★☆☆☆☆
Found in Text Mining only
Liposarcoma Liposarcoma Pubtator 34260555 Associate
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung Neoplasms BEFREE 14647414
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of pancreas Pancreatic cancer BEFREE 29636996
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 25569233, 9931421
★☆☆☆☆
Found in Text Mining only