Gene Gene information from NCBI Gene database.
Entrez ID 9274
Gene name BAF chromatin remodeling complex subunit BCL7C
Gene symbol BCL7C
Synonyms (NCBI Gene)
SMARCJ3
Chromosome 16
Chromosome location 16p11.2
Summary This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT020663 hsa-miR-155-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000, 29374058
GO:0005515 Function Protein binding IPI 33961781, 34819669
GO:0005654 Component Nucleoplasm TAS
GO:0006338 Process Chromatin remodeling NAS 10078207, 29374058
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 18809673, 29374058
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605847 1006 ENSG00000099385
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WUZ0
Protein name B-cell CLL/lymphoma 7 protein family member C
Protein function May play an anti-apoptotic role.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9931421}.
Sequence
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
Sequence length 217
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LEWY BODY DEMENTIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Squamous cell lung carcinoma - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplastic Ependymoma Anaplastic Ependymoma CTD_human_DG 26075792
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 27039262 Associate
★☆☆☆☆
Found in Text Mining only
Cellular Ependymoma Ependymoma CTD_human_DG 26075792
★☆☆☆☆
Found in Text Mining only
Ependymoma Ependymoma CTD_human_DG 26075792
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 34362400 Associate
★☆☆☆☆
Found in Text Mining only
Lewy Body Disease Lewy Body Disease GWASCAT_DG 29263008
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 9931421
★☆☆☆☆
Found in Text Mining only
Myxopapillary ependymoma Myxopapillary Ependymoma CTD_human_DG 26075792
★☆☆☆☆
Found in Text Mining only
Ovarian Diseases Ovarian diseases Pubtator 33306126 Inhibit
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 33306126 Inhibit
★☆☆☆☆
Found in Text Mining only