ARRDC1 (arrestin domain containing 1)

Gene

• Entrez ID: 92714
• Gene name: Arrestin domain containing 1
• Gene symbol: ARRDC1
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q34.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043649	hsa-miR-326	CLASH	23622248
MIRT800644	hsa-miR-1915	CLIP-seq
MIRT800645	hsa-miR-2467-3p	CLIP-seq
MIRT800646	hsa-miR-3178	CLIP-seq
MIRT800647	hsa-miR-4436b-3p	CLIP-seq
MIRT800648	hsa-miR-4486	CLIP-seq
MIRT800649	hsa-miR-4685-5p	CLIP-seq
MIRT800650	hsa-miR-4726-3p	CLIP-seq
MIRT800644	hsa-miR-1915	CLIP-seq
MIRT1936499	hsa-miR-4715-3p	CLIP-seq
MIRT1936500	hsa-miR-4755-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22315426, 23236378, 23886940, 27462458, 28514442, 32296183, 33961781, 38270169
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	22315426, 23236378, 27462458
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	27462458
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	23886940
GO:0006858	Process	Extracellular transport	IMP	22315426
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IMP	27462458
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IMP	27462458
GO:0031410	Component	Cytoplasmic vesicle	IDA	23236378
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22315426
GO:0042802	Function	Identical protein binding	IPI	22315426
GO:0045746	Process	Negative regulation of Notch signaling pathway	IMP	23886940
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	22315426
GO:0140112	Process	Extracellular vesicle biogenesis	IMP	27462458
GO:1903561	Component	Extracellular vesicle	IDA	22315426, 27462458
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IMP	27462458
GO:1990763	Function	Arrestin family protein binding	IPI	23886940

Other IDs

• MIM: 619768
• HGNC: 28633
• e!Ensembl: ENSG00000197070

Protein

• UniProt ID: Q8N5I2
• Protein name: Arrestin domain-containing protein 1 (Alpha-arrestin 1)
• Protein function: Functions as an adapter recruiting ubiquitin-protein ligases to their specific substrates (PubMed:23886940, PubMed:27462458). Through an ubiquitination-dependent mechanism plays for instance a role in the incorporation of SLC11A2 into extracellu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00339	Arrestin_N	7 → 139	Arrestin (or S-antigen), N-terminal domain	Domain
  PF02752	Arrestin_C	162 → 286	Arrestin (or S-antigen), C-terminal domain	Domain

• Sequence:

  MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
  VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
  SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
  QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
  QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
  PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
  QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
  SCGGVEPSLTPES

• Sequence length: 433

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	GWASCAT_DG	31036433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26942882	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35300565	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29416926		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29416926		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29416926		★☆☆☆☆ Found in Text Mining only