PIWIL1 (piwi like RNA-mediated gene silencing 1)

Gene

• Entrez ID: 9271
• Gene name: Piwi like RNA-mediated gene silencing 1
• Gene symbol: PIWIL1
• Synonyms (NCBI Gene): CT80.1, HIWI, MIWI, PIWI
• Chromosome: 12
• Chromosome location: 12q24.33
• Summary: This gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT675699	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT675698	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT675697	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT675696	hsa-miR-1267	HITS-CLIP	23824327
MIRT675695	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT675694	hsa-miR-4294	HITS-CLIP	23824327
MIRT675693	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT675692	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT675691	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT675690	hsa-miR-3672	HITS-CLIP	23824327
MIRT675689	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT675688	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT675687	hsa-miR-8055	HITS-CLIP	23824327
MIRT675686	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT621284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT650337	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT650336	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT650335	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621283	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT621282	hsa-miR-8073	HITS-CLIP	23824327
MIRT650334	hsa-miR-1976	HITS-CLIP	23824327
MIRT621276	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT621275	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT621274	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT621285	hsa-miR-3126-3p	HITS-CLIP	23824327
MIRT621284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT621283	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT621282	hsa-miR-8073	HITS-CLIP	23824327
MIRT621281	hsa-miR-4794	HITS-CLIP	23824327
MIRT621280	hsa-miR-664a-5p	HITS-CLIP	23824327
MIRT621279	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT621278	hsa-miR-3064-5p	HITS-CLIP	23824327
MIRT621277	hsa-miR-6504-5p	HITS-CLIP	23824327
MIRT621276	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT621275	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT621274	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT621273	hsa-miR-222-3p	HITS-CLIP	23824327
MIRT675699	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT675698	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT675697	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT675696	hsa-miR-1267	HITS-CLIP	23824327
MIRT675695	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT675694	hsa-miR-4294	HITS-CLIP	23824327
MIRT675693	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT675692	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT675691	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT675690	hsa-miR-3672	HITS-CLIP	23824327
MIRT675689	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT675688	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT675687	hsa-miR-8055	HITS-CLIP	23824327
MIRT675686	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT621284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT650337	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT650336	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT650335	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621283	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT621282	hsa-miR-8073	HITS-CLIP	23824327
MIRT650334	hsa-miR-1976	HITS-CLIP	23824327
MIRT621276	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT621275	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT621274	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT621285	hsa-miR-3126-3p	HITS-CLIP	23824327
MIRT621284	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT621283	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT621282	hsa-miR-8073	HITS-CLIP	23824327
MIRT621281	hsa-miR-4794	HITS-CLIP	23824327
MIRT621280	hsa-miR-664a-5p	HITS-CLIP	23824327
MIRT621279	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT621278	hsa-miR-3064-5p	HITS-CLIP	23824327
MIRT621277	hsa-miR-6504-5p	HITS-CLIP	23824327
MIRT621276	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT621275	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT621274	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT621273	hsa-miR-222-3p	HITS-CLIP	23824327
MIRT1237042	hsa-miR-1224-3p	CLIP-seq
MIRT1237043	hsa-miR-3160-3p	CLIP-seq
MIRT1237044	hsa-miR-3658	CLIP-seq
MIRT1237045	hsa-miR-4487	CLIP-seq
MIRT1237046	hsa-miR-4662a-3p	CLIP-seq
MIRT1237047	hsa-miR-556-5p	CLIP-seq
MIRT1237048	hsa-miR-558	CLIP-seq
MIRT2069711	hsa-miR-4282	CLIP-seq
MIRT2069712	hsa-miR-4520a-3p	CLIP-seq
MIRT2069713	hsa-miR-4520b-3p	CLIP-seq
MIRT2069714	hsa-miR-4529-3p	CLIP-seq
MIRT2069715	hsa-miR-548c-3p	CLIP-seq
MIRT2069716	hsa-miR-9	CLIP-seq
MIRT2069712	hsa-miR-4520a-3p	CLIP-seq
MIRT2069713	hsa-miR-4520b-3p	CLIP-seq
MIRT2069714	hsa-miR-4529-3p	CLIP-seq
MIRT2069715	hsa-miR-548c-3p	CLIP-seq
MIRT2069716	hsa-miR-9	CLIP-seq
MIRT2069712	hsa-miR-4520a-3p	CLIP-seq
MIRT2069713	hsa-miR-4520b-3p	CLIP-seq
MIRT2069714	hsa-miR-4529-3p	CLIP-seq
MIRT2069715	hsa-miR-548c-3p	CLIP-seq
MIRT2069716	hsa-miR-9	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IBA
GO:0004521	Function	RNA endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	ISS
GO:0005515	Function	Protein binding	IPI	14749716, 20937909, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006417	Process	Regulation of translation	IEA
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	IMP	28552346
GO:0007286	Process	Spermatid development	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IBA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	ISS
GO:0033391	Component	Chromatoid body	IEA
GO:0033391	Component	Chromatoid body	ISS
GO:0034584	Function	PiRNA binding	IBA
GO:0034584	Function	PiRNA binding	IDA	28552346
GO:0034584	Function	PiRNA binding	IEA
GO:0034587	Process	PiRNA processing	IBA
GO:0035092	Process	Sperm DNA condensation	IEA
GO:0035092	Process	Sperm DNA condensation	ISS
GO:0043186	Component	P granule	IBA
GO:0043186	Component	P granule	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0097433	Component	Dense body	IEA
GO:0140262	Function	MRNA cap binding complex binding	IEA
GO:0140990	Process	Primary piRNA processing	IEA
GO:0140990	Process	Primary piRNA processing	ISS
GO:0140991	Process	PiRNA-mediated gene silencing by mRNA destabilization	IEA
GO:0141006	Process	Transposable element silencing by piRNA-mediated heterochromatin formation	IEA
GO:0141006	Process	Transposable element silencing by piRNA-mediated heterochromatin formation	ISS

Other IDs

• MIM: 605571
• HGNC: 9007
• e!Ensembl: ENSG00000125207

Protein

• UniProt ID: Q96J94
• Protein name: Piwi-like protein 1 (EC 3.1.26.-)
• Protein function: Endoribonuclease that plays a central role in postnatal germ cells by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the rep
• PDB: 2L5C, 2L5D, 3O3I, 3O6E, 3O7V, 6PI7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05831	GAGE	1 → 106	GAGE protein	Family
  PF08699	ArgoL1	227 → 276	Argonaute linker 1 domain	Domain
  PF02170	PAZ	280 → 413	PAZ domain	Domain
  PF02171	Piwi	555 → 847	Piwi domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spermatocytes and spermatids. Also detected in prostate cancer (at protein level). Detected in most fetal and adult tissues. Expressed in testes, specifically in germline cells; detected in spermatocytes and spermatids dur
• Sequence:

  MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
  KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
  LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
  VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
  IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
  KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
  VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
  VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
  ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
  YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
  ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
  RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
  LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
  SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
  LVGQSIHREPNLSLSNRLYYL

• Sequence length: 861

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Male infertility	Likely pathogenic	rs369068461	RCV004573388	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PIWIL1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30555542		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29168346		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18781170		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33213512	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35015250	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	18781170	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27893851, 37325646	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33620673	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37325646	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	29286006		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	29317647	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	31377750, 36017582	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	31377750		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	33877510	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23629745, 25313140, 26847393, 26957540, 27177224, 27414029, 29599319, 30636640, 31789396		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	29599319		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22639842, 25292027, 27414029, 33960684	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24247010, 24440970, 24509249, 24532429, 26317901, 32503542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21989785, 27429044, 33633112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23621188, 25007054, 28423657		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24440970, 24932571, 25630839, 38012622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24509249, 26071182	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24440970, 25630839, 29320577		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29599319		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	24509249		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29976566		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24532429, 25740697, 26026091, 28634417, 29382334, 31694219		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24532429, 28634417, 29382334, 31694219	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26355242	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28109471		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19047128, 30488095		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30145353		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30145353		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28711973		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29599319		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26056945		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32503542	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24440970, 25630839		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19995427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19995427	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	30294341		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28842123		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28842123		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25269862, 30305135		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23071822, 26852287		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23071822	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27329591	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	24524831, 29286006, 29317647	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21327579, 23868705, 27429044, 27670743, 29928347		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	27429044	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22591718, 25007054, 28423657, 29168346	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22670175, 25292027	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24440970, 24532429, 28634417	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23071822, 26852287		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23629745, 25313140, 26847393, 26957540, 27177224, 27414029, 29599319, 30636640, 31789396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26056945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25269862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23621188, 25007054, 28423657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31443431		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16287078, 25779424, 30584336		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16287078, 20200493, 21766210, 25895683, 25929784, 26013764, 26026091, 26056945, 26360585, 26768585, 26852287, 26957540, 27177224, 27197292, 27289065, 28109471, 28529570, 28634417, 28882222, 29130960, 29599319, 29963267, 30226604, 30488095, 30555542, 30636640, 30701019, 30854037, 31110013, 31399034, 31478570, 31691558, 31727866, 31814070		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29976566		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27578485, 27858163		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27578485	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24440970, 24509249, 25269862, 25742785, 26026091, 27289065, 28529570, 28634417, 29168346, 29301509, 29928347, 30584336, 31262447, 31443431		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31838836		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31478570		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31838836		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25742785		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24932571	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31443431		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25910082	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34200970	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19047128, 24509249		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28861107		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27893851		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16953229		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31612310		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	12037681, 26843623		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24247010	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28109471	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28325293		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27323410, 28109471, 29435129, 30854037		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16287078, 25779424, 30584336		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16287078		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22670175, 30598579, 33169519	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	24247010, 29301509	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	26265322		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	24247010	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31789396		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	28697848		★☆☆☆☆ Found in Text Mining only