Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9270
Gene name	Integrin subunit beta 1 binding protein 1
Gene symbol	ITGB1BP1
Synonyms (NCBI Gene)	ICAP-1AICAP-1BICAP-1alphaICAP1ICAP1AICAP1B
Chromosome	2
Chromosome location	2p25.1
Summary	The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments
MIRT1074092	hsa-miR-383	CLIP-seq
MIRT1074093	hsa-miR-3941	CLIP-seq
MIRT1074094	hsa-miR-4310	CLIP-seq
MIRT1074095	hsa-miR-466	CLIP-seq
MIRT1074096	hsa-miR-4672	CLIP-seq
MIRT1074097	hsa-miR-4731-3p	CLIP-seq
MIRT1074098	hsa-miR-4772-5p	CLIP-seq
MIRT1074099	hsa-miR-4801	CLIP-seq
MIRT1074100	hsa-miR-153	CLIP-seq
MIRT1074101	hsa-miR-3143	CLIP-seq
MIRT1074102	hsa-miR-4291	CLIP-seq
MIRT1074094	hsa-miR-4310	CLIP-seq
MIRT1074103	hsa-miR-448	CLIP-seq
MIRT1074104	hsa-miR-4528	CLIP-seq
MIRT1074105	hsa-miR-543	CLIP-seq
MIRT2018307	hsa-miR-1228	CLIP-seq
MIRT2018308	hsa-miR-3687	CLIP-seq
MIRT2018309	hsa-miR-4257	CLIP-seq
MIRT2018310	hsa-miR-4442	CLIP-seq
MIRT2250168	hsa-miR-1245b-5p	CLIP-seq
MIRT2250169	hsa-miR-1972	CLIP-seq
MIRT2250170	hsa-miR-3142	CLIP-seq
MIRT2250171	hsa-miR-3913-3p	CLIP-seq
MIRT2250172	hsa-miR-4276	CLIP-seq
MIRT2250173	hsa-miR-4302	CLIP-seq
MIRT2250174	hsa-miR-4504	CLIP-seq
MIRT2250175	hsa-miR-4650-5p	CLIP-seq
MIRT2250176	hsa-miR-4677-3p	CLIP-seq
MIRT2250177	hsa-miR-4679	CLIP-seq
MIRT2250178	hsa-miR-489	CLIP-seq
MIRT2250179	hsa-miR-542-3p	CLIP-seq
MIRT2250180	hsa-miR-668	CLIP-seq
MIRT1074094	hsa-miR-4310	CLIP-seq

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001726	Component	Ruffle	IBA
GO:0001726	Component	Ruffle	IDA	11919189
GO:0001726	Component	Ruffle	IEA
GO:0002043	Process	Blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IDA	20616313
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	11807099
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	15703214
GO:0005178	Function	Integrin binding	IPI	12473654
GO:0005515	Function	Protein binding	IPI	9281591, 11807099, 11919189, 15703214, 17916086, 25416956, 25814554, 25910212, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	12473654, 15703214
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11919189, 12473654, 15703214
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11919189
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005925	Component	Focal adhesion	IDA	11919189, 12473654
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	20616313
GO:0006933	Process	Negative regulation of cell adhesion involved in substrate-bound cell migration	IEA
GO:0006933	Process	Negative regulation of cell adhesion involved in substrate-bound cell migration	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IDA	9281591
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	11919189, 15703214
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15703214
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20616313
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	20616313
GO:0010764	Process	Negative regulation of fibroblast migration	IEA
GO:0010764	Process	Negative regulation of fibroblast migration	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9281591
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	TAS	11919189
GO:0016604	Component	Nuclear body	IDA
GO:0019900	Function	Kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IDA	11919189
GO:0030027	Component	Lamellipodium	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	12473654
GO:0032148	Process	Activation of protein kinase B activity	IDA	20616313
GO:0033622	Process	Integrin activation	IDA	23317506
GO:0033622	Process	Integrin activation	IEA
GO:0033622	Process	Integrin activation	ISS
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	ISS
GO:0034451	Component	Centriolar satellite	IDA
GO:0035148	Process	Tube formation	IDA	20616313
GO:0035556	Process	Intracellular signal transduction	TAS	9813144
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	20616313
GO:0042995	Component	Cell projection	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	11807099
GO:0043113	Process	Receptor clustering	IEA
GO:0043113	Process	Receptor clustering	ISS
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IDA	20616313
GO:0045747	Process	Positive regulation of Notch signaling pathway	IDA	20616313
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15703214, 20616313
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11919189
GO:0051451	Process	Myoblast migration	IEA
GO:0051451	Process	Myoblast migration	ISS
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IBA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IDA	12473654
GO:0051895	Process	Negative regulation of focal adhesion assembly	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20616313
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	20616313
GO:0071944	Component	Cell periphery	IBA
GO:0071944	Component	Cell periphery	IDA	11919189
GO:0071944	Component	Cell periphery	IEA
GO:0072657	Process	Protein localization to membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	17916086
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IDA	20616313
GO:0090313	Process	Regulation of protein targeting to membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0090315	Process	Negative regulation of protein targeting to membrane	IDA	11807099
GO:0097746	Process	Blood vessel diameter maintenance	IDA	20616313
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IBA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IDA	11807099
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	IEA
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	ISS

MIM	HGNC	e!Ensembl
607153	23927	ENSG00000119185

O14713

Protein name

Integrin beta-1-binding protein 1 (Integrin cytoplasmic domain-associated protein 1) (ICAP-1)

Protein function

Key regulator of the integrin-mediated cell-matrix interaction signaling by binding to the ITGB1 cytoplasmic tail and preventing the activation of integrin alpha-5/beta-1 (heterodimer of ITGA5 and ITGB1) by talin or FERMT1. Plays a role in cell

PDB

4DX8 , 4DX9 , 4JIF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10480	ICAP-1_inte_bdg	1 → 200	Beta-1 integrin binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells and fibroblasts (at protein level). Ubiquitously expressed. Expressed in intestine, colon, testis, ovary, thymus, spleen and prostate. {ECO:0000269|PubMed:9281591, ECO:0000269|PubMed:9867804}.

Sequence

MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP

Sequence length

200

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, DEVELOPMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bone Diseases, Developmental	Bone Disease	CTD_human_DG	17567669		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36212176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26658839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31424965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26658839		★★★★★ ★☆☆☆☆ Found in Text Mining only

ITGB1BP1 (integrin subunit beta 1 binding protein 1)