Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	92675
Gene name	D-aminoacyl-tRNA deacylase 1
Gene symbol	DTD1
Synonyms (NCBI Gene)	C20orf88DTDDUE-BDUEBHARS2pqn-68
Chromosome	20
Chromosome location	20p11.23
Summary	The protein encoded by this gene is similar in sequence to histidyl-tRNA synthetase, which hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). The encoded protein binds the DNA unwinding element and plays a role in the initiation of DNA rep

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021511	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT031804	hsa-miR-16-5p	Proteomics	18668040
MIRT152457	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT152457	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT946545	hsa-miR-3120-3p	CLIP-seq
MIRT946546	hsa-miR-4280	CLIP-seq
MIRT946547	hsa-miR-4452	CLIP-seq
MIRT946548	hsa-miR-4635	CLIP-seq
MIRT946549	hsa-miR-483-3p	CLIP-seq
MIRT946550	hsa-miR-548a-5p	CLIP-seq
MIRT946551	hsa-miR-548ab	CLIP-seq
MIRT946552	hsa-miR-548ak	CLIP-seq
MIRT946553	hsa-miR-548b-5p	CLIP-seq
MIRT946554	hsa-miR-548c-5p	CLIP-seq
MIRT946555	hsa-miR-548d-5p	CLIP-seq
MIRT946556	hsa-miR-548h	CLIP-seq
MIRT946557	hsa-miR-548i	CLIP-seq
MIRT946558	hsa-miR-548j	CLIP-seq
MIRT946559	hsa-miR-548k	CLIP-seq
MIRT946560	hsa-miR-548l	CLIP-seq
MIRT946561	hsa-miR-548w	CLIP-seq
MIRT946562	hsa-miR-548y	CLIP-seq
MIRT946563	hsa-miR-559	CLIP-seq
MIRT1980368	hsa-miR-1280	CLIP-seq
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT1980369	hsa-miR-3117-5p	CLIP-seq
MIRT1980370	hsa-miR-34a	CLIP-seq
MIRT1980371	hsa-miR-34c-5p	CLIP-seq
MIRT1980372	hsa-miR-371b-3p	CLIP-seq
MIRT1980373	hsa-miR-421	CLIP-seq
MIRT1980374	hsa-miR-449a	CLIP-seq
MIRT1980375	hsa-miR-449b	CLIP-seq
MIRT1980376	hsa-miR-602	CLIP-seq
MIRT2215381	hsa-miR-145	CLIP-seq
MIRT2215382	hsa-miR-1913	CLIP-seq
MIRT1980369	hsa-miR-3117-5p	CLIP-seq
MIRT2215383	hsa-miR-3194-5p	CLIP-seq
MIRT2215384	hsa-miR-324-3p	CLIP-seq
MIRT1980373	hsa-miR-421	CLIP-seq
MIRT2215385	hsa-miR-4277	CLIP-seq
MIRT2215386	hsa-miR-4640-5p	CLIP-seq
MIRT2215387	hsa-miR-4661-3p	CLIP-seq
MIRT2215388	hsa-miR-4726-5p	CLIP-seq
MIRT2215389	hsa-miR-4727-5p	CLIP-seq
MIRT2215390	hsa-miR-514	CLIP-seq
MIRT2215391	hsa-miR-514b-3p	CLIP-seq
MIRT1980376	hsa-miR-602	CLIP-seq
MIRT2448559	hsa-miR-1228	CLIP-seq
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT2448559	hsa-miR-1228	CLIP-seq
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT2448559	hsa-miR-1228	CLIP-seq
MIRT2519810	hsa-miR-1270	CLIP-seq
MIRT2519811	hsa-miR-128	CLIP-seq
MIRT2519812	hsa-miR-1291	CLIP-seq
MIRT2519813	hsa-miR-129-5p	CLIP-seq
MIRT2519814	hsa-miR-1322	CLIP-seq
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT2519815	hsa-miR-217	CLIP-seq
MIRT2519816	hsa-miR-2467-3p	CLIP-seq
MIRT1980369	hsa-miR-3117-5p	CLIP-seq
MIRT946545	hsa-miR-3120-3p	CLIP-seq
MIRT2519817	hsa-miR-3120-5p	CLIP-seq
MIRT2519818	hsa-miR-3121-5p	CLIP-seq
MIRT2519819	hsa-miR-3128	CLIP-seq
MIRT2519820	hsa-miR-3133	CLIP-seq
MIRT1980370	hsa-miR-34a	CLIP-seq
MIRT1980371	hsa-miR-34c-5p	CLIP-seq
MIRT2519821	hsa-miR-3659	CLIP-seq
MIRT2519822	hsa-miR-3678-3p	CLIP-seq
MIRT1980372	hsa-miR-371b-3p	CLIP-seq
MIRT1980373	hsa-miR-421	CLIP-seq
MIRT2519823	hsa-miR-4258	CLIP-seq
MIRT2519824	hsa-miR-4302	CLIP-seq
MIRT2519825	hsa-miR-4434	CLIP-seq
MIRT1980374	hsa-miR-449a	CLIP-seq
MIRT1980375	hsa-miR-449b	CLIP-seq
MIRT2519826	hsa-miR-450b-5p	CLIP-seq
MIRT2519827	hsa-miR-4516	CLIP-seq
MIRT2519828	hsa-miR-4520a-3p	CLIP-seq
MIRT2519829	hsa-miR-4531	CLIP-seq
MIRT2215386	hsa-miR-4640-5p	CLIP-seq
MIRT2519830	hsa-miR-4652-3p	CLIP-seq
MIRT2519831	hsa-miR-4658	CLIP-seq
MIRT2519832	hsa-miR-4694-5p	CLIP-seq
MIRT2519833	hsa-miR-4711-5p	CLIP-seq
MIRT2215388	hsa-miR-4726-5p	CLIP-seq
MIRT2519834	hsa-miR-4731-5p	CLIP-seq
MIRT2519835	hsa-miR-4802-3p	CLIP-seq
MIRT946549	hsa-miR-483-3p	CLIP-seq
MIRT2519836	hsa-miR-507	CLIP-seq
MIRT2519837	hsa-miR-548ad	CLIP-seq
MIRT2519838	hsa-miR-553	CLIP-seq
MIRT2519839	hsa-miR-557	CLIP-seq
MIRT2519840	hsa-miR-574-5p	CLIP-seq
MIRT2519841	hsa-miR-589	CLIP-seq
MIRT1980376	hsa-miR-602	CLIP-seq
MIRT2519842	hsa-miR-620	CLIP-seq
MIRT2519843	hsa-miR-9	CLIP-seq
MIRT2448559	hsa-miR-1228	CLIP-seq
MIRT2519810	hsa-miR-1270	CLIP-seq
MIRT2519811	hsa-miR-128	CLIP-seq
MIRT2519812	hsa-miR-1291	CLIP-seq
MIRT2519813	hsa-miR-129-5p	CLIP-seq
MIRT2519814	hsa-miR-1322	CLIP-seq
MIRT946544	hsa-miR-140-3p	CLIP-seq
MIRT2519815	hsa-miR-217	CLIP-seq
MIRT2519816	hsa-miR-2467-3p	CLIP-seq
MIRT1980369	hsa-miR-3117-5p	CLIP-seq
MIRT946545	hsa-miR-3120-3p	CLIP-seq
MIRT2519818	hsa-miR-3121-5p	CLIP-seq
MIRT2519819	hsa-miR-3128	CLIP-seq
MIRT2519820	hsa-miR-3133	CLIP-seq
MIRT1980370	hsa-miR-34a	CLIP-seq
MIRT1980371	hsa-miR-34c-5p	CLIP-seq
MIRT2519821	hsa-miR-3659	CLIP-seq
MIRT2519822	hsa-miR-3678-3p	CLIP-seq
MIRT1980372	hsa-miR-371b-3p	CLIP-seq
MIRT1980373	hsa-miR-421	CLIP-seq
MIRT2519823	hsa-miR-4258	CLIP-seq
MIRT2519824	hsa-miR-4302	CLIP-seq
MIRT2519825	hsa-miR-4434	CLIP-seq
MIRT1980374	hsa-miR-449a	CLIP-seq
MIRT1980375	hsa-miR-449b	CLIP-seq
MIRT2519826	hsa-miR-450b-5p	CLIP-seq
MIRT2519827	hsa-miR-4516	CLIP-seq
MIRT2519828	hsa-miR-4520a-3p	CLIP-seq
MIRT2519829	hsa-miR-4531	CLIP-seq
MIRT2519831	hsa-miR-4658	CLIP-seq
MIRT2519832	hsa-miR-4694-5p	CLIP-seq
MIRT2519833	hsa-miR-4711-5p	CLIP-seq
MIRT2519834	hsa-miR-4731-5p	CLIP-seq
MIRT2519835	hsa-miR-4802-3p	CLIP-seq
MIRT946549	hsa-miR-483-3p	CLIP-seq
MIRT2519836	hsa-miR-507	CLIP-seq
MIRT2519837	hsa-miR-548ad	CLIP-seq
MIRT2519838	hsa-miR-553	CLIP-seq
MIRT2519839	hsa-miR-557	CLIP-seq
MIRT2519840	hsa-miR-574-5p	CLIP-seq
MIRT2519841	hsa-miR-589	CLIP-seq
MIRT1980376	hsa-miR-602	CLIP-seq
MIRT2519842	hsa-miR-620	CLIP-seq
MIRT2519843	hsa-miR-9	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0002161	Function	Aminoacyl-tRNA deacylase activity	IEA
GO:0003677	Function	DNA binding	EXP	17264083
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0006260	Process	DNA replication	IEA
GO:0006399	Process	TRNA metabolic process	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051499	Function	D-aminoacyl-tRNA deacylase activity	IEA
GO:0051500	Function	D-tyrosyl-tRNA(Tyr) deacylase activity	IBA
GO:0106026	Function	Gly-tRNA(Ala) deacylase activity	IEA
GO:0106074	Process	Aminoacyl-tRNA metabolism involved in translational fidelity	IEA

MIM	HGNC	e!Ensembl
610996	16219	ENSG00000125821

Q8TEA8

Protein name

D-aminoacyl-tRNA deacylase 1 (DTD) (EC 3.1.1.96) (DNA-unwinding element-binding protein B) (DUE-B) (Gly-tRNA(Ala) deacylase) (Histidyl-tRNA synthase-related)

Protein function

Possible ATPase (PubMed:15653697) involved in DNA replication, may facilitate loading of CDC45 onto pre-replication complexes (PubMed:20065034). ; An aminoacyl-tRNA editing enz

PDB

2OKV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02580	Tyr_Deacylase	2 → 146	D-Tyr-tRNA(Tyr) deacylase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many adult and fetal tissues. Highest levels in testis, ovary, spleen and in adult and fetal brain. {ECO:0000269|PubMed:12392168}.

Sequence

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESG
KHWSKSVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPE
LIKDGKFGAYMQVHIQNDGPVTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSE
SSKERNTPRKEDRSASSGAEGDVSSEREP

Sequence length

209

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DRY EYE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	10192399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21479357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	21479357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10430027, 17522890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	31501329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1737339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	31819004, 33228777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16192292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	10192399, 1345170, 8487268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24772479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26264438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26264438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26264438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal dysgenesis XX type deafness	Gonadal Dysgenesis	BEFREE	21464306, 23541340, 23748049, 31449985, 31827252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal dysgenesis XX type deafness	Gonadal Dysgenesis	ORPHANET_DG	21464306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal dysgenesis XX type deafness	Gonadal dysgenesis	Pubtator	23541340, 26657938, 27087618, 31827252, 33228777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	31827252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	31827252, 33228777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	30560888, 31403245, 9218821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	17665459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	24898250, 30560888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	1324793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11085512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	1324793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31819004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	24067379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	10430027, 1721933, 22582345, 2476503, 24898250, 9287147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1737339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	1324793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	31827252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33228777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian dysgenesis	Ovarian Dysgenesis	BEFREE	21464306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31827252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	30937586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral axonal neuropathy	Peripheral axonal neuropathy	BEFREE	29235198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	22930593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	31827252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	22930593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perrault syndrome	Perrault Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
PERRAULT SYNDROME 2	Perrault Syndrome	UNIPROT_DG	21464306, 31449985		★★★★★ ★☆☆☆☆ Found in Text Mining only
PERRAULT SYNDROME 2	Perrault Syndrome	CLINVAR_DG	21464306		★★★★★ ★☆☆☆☆ Found in Text Mining only
PERRAULT SYNDROME 2	Perrault Syndrome	GENOMICS_ENGLAND_DG	21464306, 27650058		★★★★★ ★☆☆☆☆ Found in Text Mining only
PERRAULT SYNDROME 2	Perrault Syndrome	CLINGEN_DG	21464306, 27650058, 28263850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	26291516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	31449985, 31827252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16192292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	21464306, 31449985, 31827252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11085512		★★★★★ ★☆☆☆☆ Found in Text Mining only
USHER SYNDROME, TYPE IIIB	Usher Syndrome	BEFREE	28632987		★★★★★ ★☆☆☆☆ Found in Text Mining only

DTD1 (D-aminoacyl-tRNA deacylase 1)