Gene Gene information from NCBI Gene database.
Entrez ID 92609
Gene name Translocase of inner mitochondrial membrane 50
Gene symbol TIMM50
Synonyms (NCBI Gene)
MGCA9TIM50TIM50L
Chromosome 19
Chromosome location 19q13.2
Summary This gene encodes a subunit of the TIM23 inner mitochondrial membrane translocase complex. The encoded protein functions as the receptor subunit that recognizes the mitochondrial targeting signal, or presequence, on protein cargo that is destined for the
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs35135520 C>A,G,T Benign, pathogenic Coding sequence variant, stop gained, missense variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs776019250 G>C,T Pathogenic Missense variant, 5 prime UTR variant, coding sequence variant
rs797044891 G>A Pathogenic Missense variant, coding sequence variant
rs1244226820 C>T Pathogenic Coding sequence variant, missense variant
rs1300848445 C>T Pathogenic Intron variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
458
miRTarBase ID miRNA Experiments Reference
MIRT016403 hsa-miR-193b-3p Proteomics 21512034
MIRT025669 hsa-miR-7-5p Microarray 19073608
MIRT052037 hsa-let-7b-5p CLASH 23622248
MIRT051530 hsa-let-7e-5p CLASH 23622248
MIRT046584 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0001836 Process Release of cytochrome c from mitochondria IDA 15044455
GO:0003723 Function RNA binding IEA
GO:0004721 Function Phosphoprotein phosphatase activity IDA 15044455
GO:0004722 Function Protein serine/threonine phosphatase activity IDA 15044455
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607381 23656 ENSG00000105197
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3ZCQ8
Protein name Mitochondrial import inner membrane translocase subunit TIM50
Protein function Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane (PubMed:30190335, PubMed:38828998). Has some phosphatase activity in vitro; howeve
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03031 NIF 148 295 NLI interacting factor-like phosphatase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level). {ECO:0000269|PubMed:15044455, ECO:0000269|PubMed:16008839}.
Sequence
MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGP
SYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFK
DYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETL
FQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVR
TVLEH
YALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
Sequence length 353
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
17
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
3-methylglutaconic aciduria type 9 Likely pathogenic; Pathogenic rs1457024558, rs797044891, rs1244226820, rs1305711807, rs776019250, rs35135520 RCV002308496
RCV001812182
RCV000509024
RCV000578358
RCV001328001
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial encephalopathy Pathogenic rs776019250, rs35135520 RCV000677433
RCV000677434
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
3-METHYLGLUTACONIC ACIDURIA, TYPE IX 3-Methylglutaconic aciduria GENOMICS_ENGLAND_DG 27573165, 31058414
★☆☆☆☆
Found in Text Mining only
3-METHYLGLUTACONIC ACIDURIA, TYPE IX 3-Methylglutaconic aciduria UNIPROT_DG 27573165
★☆☆☆☆
Found in Text Mining only
3-METHYLGLUTACONIC ACIDURIA, TYPE IX 3-Methylglutaconic aciduria ORPHANET_DG 27573165
★☆☆☆☆
Found in Text Mining only
3-METHYLGLUTACONIC ACIDURIA, TYPE IX 3-Methylglutaconic aciduria CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 30190335 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 21621504, 30604908
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 21621504 Stimulate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 26289846 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy BEFREE 31058414
★☆☆☆☆
Found in Text Mining only