Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	926
Gene name	CD8 subunit beta
Gene symbol	CD8B
Synonyms (NCBI Gene)	CD8B1CD8betaLEU2LY3LYT3Ly-3P37
Chromosome	2
Chromosome location	2p11.2
Summary	The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize an

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments
MIRT876404	hsa-miR-147	CLIP-seq
MIRT876405	hsa-miR-3650	CLIP-seq
MIRT876406	hsa-miR-3689a-3p	CLIP-seq
MIRT876407	hsa-miR-3689c	CLIP-seq
MIRT876408	hsa-miR-3911	CLIP-seq
MIRT876409	hsa-miR-3919	CLIP-seq
MIRT876410	hsa-miR-3921	CLIP-seq
MIRT876411	hsa-miR-4303	CLIP-seq
MIRT876412	hsa-miR-4455	CLIP-seq
MIRT876413	hsa-miR-4648	CLIP-seq
MIRT876414	hsa-miR-4653-5p	CLIP-seq
MIRT876415	hsa-miR-4654	CLIP-seq
MIRT876416	hsa-miR-4661-3p	CLIP-seq
MIRT876417	hsa-miR-4728-5p	CLIP-seq
MIRT876418	hsa-miR-4769-5p	CLIP-seq
MIRT876419	hsa-miR-593	CLIP-seq
MIRT876420	hsa-miR-609	CLIP-seq
MIRT876421	hsa-miR-642a	CLIP-seq
MIRT876422	hsa-miR-644	CLIP-seq
MIRT1959725	hsa-miR-3545-3p	CLIP-seq
MIRT1959726	hsa-miR-3925-3p	CLIP-seq
MIRT1959727	hsa-miR-4680-5p	CLIP-seq
MIRT1959728	hsa-miR-4685-5p	CLIP-seq
MIRT1959729	hsa-miR-766	CLIP-seq
MIRT2196778	hsa-miR-3183	CLIP-seq
MIRT2196779	hsa-miR-3667-5p	CLIP-seq
MIRT2196780	hsa-miR-4723-3p	CLIP-seq
MIRT2196781	hsa-miR-711	CLIP-seq
MIRT2499924	hsa-miR-1914	CLIP-seq
MIRT2499925	hsa-miR-218	CLIP-seq
MIRT2499926	hsa-miR-492	CLIP-seq
MIRT2499927	hsa-miR-636	CLIP-seq
MIRT2499924	hsa-miR-1914	CLIP-seq
MIRT2499925	hsa-miR-218	CLIP-seq
MIRT2499926	hsa-miR-492	CLIP-seq
MIRT2499927	hsa-miR-636	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
GATA3	Unknown	11937547
SATB1	Unknown	11937547

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	17145893
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	2493728
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISO
GO:0005886	Component	Plasma membrane	TAS	3145195
GO:0006955	Process	Immune response	NAS	11131152
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	NAS	9830036
GO:0009986	Component	Cell surface	IBA
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	NAS	11131152
GO:0016020	Component	Membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0042101	Component	T cell receptor complex	NAS	11131152
GO:0042110	Process	T cell activation	IDA	17145893
GO:0042110	Process	T cell activation	NAS	9830036
GO:0042288	Function	MHC class I protein binding	IEA
GO:0042288	Function	MHC class I protein binding	NAS	11131152
GO:0043235	Component	Receptor complex	ISO
GO:0050776	Process	Regulation of immune response	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	17145893

MIM	HGNC	e!Ensembl
186730	1707	ENSG00000172116

P10966

Protein name

T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b)

Protein function

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	24 → 135	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isofo

Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK

Sequence length

210

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage T cell receptor signaling pathway Yersinia infection Primary immunodeficiency		Nef Mediated CD8 Down-regulation Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10516767, 11264177, 9395242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38263419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35739510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32433748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10516767, 11264177, 3319675, 9395242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33324408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30683885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35090306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11161783, 9395242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28036384, 28976984, 30980864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	24297179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	24297179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24297179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	24297179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	3011639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21062494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28036384, 30387832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10516767, 9395242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33791375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	33791375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	21685912		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASDB_DG	21685912		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31211828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	31211828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26871709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21062494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35090306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD8B (CD8 subunit beta)