GPR50 (G protein-coupled receptor 50)

Gene

• Entrez ID: 9248
• Gene name: G protein-coupled receptor 50
• Gene symbol: GPR50
• Synonyms (NCBI Gene): H9, Mel1c
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene product belongs to the G-protein coupled receptor 1 family. Even though this protein shares similarity with the melatonin receptors, it does not bind melatonin, however, it inhibits melatonin receptor 1A function through heterodimerization. Poly

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017000	hsa-miR-335-5p	Microarray	18185580
MIRT707688	hsa-miR-603	HITS-CLIP	21572407
MIRT707679	hsa-miR-101-3p	HITS-CLIP	21572407
MIRT707687	hsa-miR-144-3p	HITS-CLIP	21572407
MIRT707686	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT707685	hsa-miR-216b-3p	HITS-CLIP	21572407
MIRT707684	hsa-miR-1911-5p	HITS-CLIP	21572407
MIRT707683	hsa-miR-1255a	HITS-CLIP	21572407
MIRT707682	hsa-miR-1255b-5p	HITS-CLIP	21572407
MIRT707681	hsa-miR-374c-5p	HITS-CLIP	21572407
MIRT707680	hsa-miR-655-3p	HITS-CLIP	21572407
MIRT707679	hsa-miR-101-3p	HITS-CLIP	21572407
MIRT707678	hsa-miR-4703-5p	HITS-CLIP	21572407
MIRT707688	hsa-miR-603	HITS-CLIP	21572407
MIRT707679	hsa-miR-101-3p	HITS-CLIP	21572407
MIRT707687	hsa-miR-144-3p	HITS-CLIP	21572407
MIRT707686	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT707685	hsa-miR-216b-3p	HITS-CLIP	21572407
MIRT707684	hsa-miR-1911-5p	HITS-CLIP	21572407
MIRT707683	hsa-miR-1255a	HITS-CLIP	21572407
MIRT707682	hsa-miR-1255b-5p	HITS-CLIP	21572407
MIRT707681	hsa-miR-374c-5p	HITS-CLIP	21572407
MIRT707680	hsa-miR-655-3p	HITS-CLIP	21572407
MIRT707679	hsa-miR-101-3p	HITS-CLIP	21572407
MIRT707678	hsa-miR-4703-5p	HITS-CLIP	21572407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	8647286
GO:0005515	Function	Protein binding	IPI	16778767, 25416956, 32405532
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8647286
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8647286
GO:0007267	Process	Cell-cell signaling	TAS	8647286
GO:0008502	Function	Melatonin receptor activity	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IEA

Other IDs

• MIM: 300207
• HGNC: 4506
• e!Ensembl: ENSG00000102195

Protein

• UniProt ID: Q13585
• Protein name: Melatonin-related receptor (G protein-coupled receptor 50) (H9) [Cleaved into: C-terminal domain]
• Protein function: G protein-coupled receptor that plays a role in numerous physiological processes including regulation of energy metabolism, neurite outgrowth or cell migration (PubMed:19699797). Promotes self-renewal and neuronal differentiation of neural proge
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	45 → 294	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Hypothalamus and pituitary.
• Sequence:

  MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR
  NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV
  AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF
  NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF
  VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN
  FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE
  TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP
  VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH
  HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS
  ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY
  HDVVVIDVEDDPDEMAV

• Sequence length: 617

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	31173244	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	20733416		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	25798330	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21615493		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20377855, 20657642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	20657642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	15452587, 17106423, 18075476, 20371266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15452587, 17106423, 17239033, 18075476, 20371266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	29572483		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36769125	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24997722	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19708722, 25798330		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	25798330	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28660299		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	15452587		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15452587, 18075476		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	LHGDN	15452587		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29572483		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29572483		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19708722, 25798330		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25798330		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	15452587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	18075476, 20371266, 21565467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	18075476, 19708722, 20371266, 21565467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Emery Dreifuss	Emery dreifuss muscular dystrophy	Pubtator	24997722	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29572483		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16436372		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16436372	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15452587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15452587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15452587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis	Scoliosis	Pubtator	20733416	Associate	★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	21565467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	21565467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	18075476		★☆☆☆☆ Found in Text Mining only