Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	92421
Gene name	Charged multivesicular body protein 4C
Gene symbol	CHMP4C
Synonyms (NCBI Gene)	SNF7-3Shax3VPS32C
Chromosome	8
Chromosome location	8q21.13
Summary	CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor p

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038687	hsa-miR-30c-2-3p	CLASH	23622248
MIRT890792	hsa-miR-1343	CLIP-seq
MIRT890793	hsa-miR-150	CLIP-seq
MIRT890794	hsa-miR-1976	CLIP-seq
MIRT890795	hsa-miR-24	CLIP-seq
MIRT890796	hsa-miR-3149	CLIP-seq
MIRT890797	hsa-miR-3155	CLIP-seq
MIRT890798	hsa-miR-3155b	CLIP-seq
MIRT890799	hsa-miR-3188	CLIP-seq
MIRT890800	hsa-miR-345	CLIP-seq
MIRT890801	hsa-miR-3652	CLIP-seq
MIRT890802	hsa-miR-378	CLIP-seq
MIRT890803	hsa-miR-378b	CLIP-seq
MIRT890804	hsa-miR-378c	CLIP-seq
MIRT890805	hsa-miR-378d	CLIP-seq
MIRT890806	hsa-miR-378e	CLIP-seq
MIRT890807	hsa-miR-378f	CLIP-seq
MIRT890808	hsa-miR-378g	CLIP-seq
MIRT890809	hsa-miR-378h	CLIP-seq
MIRT890810	hsa-miR-378i	CLIP-seq
MIRT890811	hsa-miR-422a	CLIP-seq
MIRT890812	hsa-miR-4266	CLIP-seq
MIRT890813	hsa-miR-4279	CLIP-seq
MIRT890814	hsa-miR-4284	CLIP-seq
MIRT890815	hsa-miR-4430	CLIP-seq
MIRT890816	hsa-miR-4437	CLIP-seq
MIRT890817	hsa-miR-4674	CLIP-seq
MIRT890818	hsa-miR-4695-5p	CLIP-seq
MIRT890819	hsa-miR-4715-3p	CLIP-seq
MIRT890820	hsa-miR-4735-5p	CLIP-seq
MIRT890821	hsa-miR-4772-3p	CLIP-seq
MIRT890822	hsa-miR-4775	CLIP-seq
MIRT890823	hsa-miR-4779	CLIP-seq
MIRT890824	hsa-miR-484	CLIP-seq
MIRT890825	hsa-miR-512-5p	CLIP-seq
MIRT890826	hsa-miR-562	CLIP-seq
MIRT890827	hsa-miR-590-3p	CLIP-seq
MIRT1964034	hsa-miR-122	CLIP-seq
MIRT1964035	hsa-miR-142-5p	CLIP-seq
MIRT890796	hsa-miR-3149	CLIP-seq
MIRT1964036	hsa-miR-340	CLIP-seq
MIRT1964037	hsa-miR-3924	CLIP-seq
MIRT1964038	hsa-miR-4699-3p	CLIP-seq
MIRT890819	hsa-miR-4715-3p	CLIP-seq
MIRT890820	hsa-miR-4735-5p	CLIP-seq
MIRT890822	hsa-miR-4775	CLIP-seq
MIRT890827	hsa-miR-590-3p	CLIP-seq
MIRT1964034	hsa-miR-122	CLIP-seq
MIRT2200206	hsa-miR-1254	CLIP-seq
MIRT2200207	hsa-miR-3116	CLIP-seq
MIRT2200208	hsa-miR-3122	CLIP-seq
MIRT2200209	hsa-miR-3153	CLIP-seq
MIRT2200210	hsa-miR-3176	CLIP-seq
MIRT2200211	hsa-miR-324-5p	CLIP-seq
MIRT2200212	hsa-miR-3622b-5p	CLIP-seq
MIRT2200213	hsa-miR-377	CLIP-seq
MIRT2200214	hsa-miR-3913-5p	CLIP-seq
MIRT2200215	hsa-miR-3922-3p	CLIP-seq
MIRT2200216	hsa-miR-4317	CLIP-seq
MIRT2200217	hsa-miR-4423-5p	CLIP-seq
MIRT2200218	hsa-miR-4668-5p	CLIP-seq
MIRT2200219	hsa-miR-4757-5p	CLIP-seq
MIRT2200220	hsa-miR-512-3p	CLIP-seq
MIRT2200221	hsa-miR-516b	CLIP-seq
MIRT2200222	hsa-miR-550a	CLIP-seq
MIRT2200223	hsa-miR-622	CLIP-seq
MIRT2200224	hsa-miR-661	CLIP-seq
MIRT2427323	hsa-miR-302f	CLIP-seq
MIRT890792	hsa-miR-1343	CLIP-seq
MIRT890794	hsa-miR-1976	CLIP-seq
MIRT2427323	hsa-miR-302f	CLIP-seq
MIRT890796	hsa-miR-3149	CLIP-seq
MIRT2200212	hsa-miR-3622b-5p	CLIP-seq
MIRT890808	hsa-miR-378g	CLIP-seq
MIRT890816	hsa-miR-4437	CLIP-seq
MIRT890817	hsa-miR-4674	CLIP-seq
MIRT890819	hsa-miR-4715-3p	CLIP-seq
MIRT890820	hsa-miR-4735-5p	CLIP-seq
MIRT890822	hsa-miR-4775	CLIP-seq
MIRT890827	hsa-miR-590-3p	CLIP-seq
MIRT1964034	hsa-miR-122	CLIP-seq
MIRT890792	hsa-miR-1343	CLIP-seq
MIRT890794	hsa-miR-1976	CLIP-seq
MIRT2427323	hsa-miR-302f	CLIP-seq
MIRT890796	hsa-miR-3149	CLIP-seq
MIRT2200212	hsa-miR-3622b-5p	CLIP-seq
MIRT890808	hsa-miR-378g	CLIP-seq
MIRT2200217	hsa-miR-4423-5p	CLIP-seq
MIRT890816	hsa-miR-4437	CLIP-seq
MIRT890817	hsa-miR-4674	CLIP-seq
MIRT890819	hsa-miR-4715-3p	CLIP-seq
MIRT890820	hsa-miR-4735-5p	CLIP-seq
MIRT890822	hsa-miR-4775	CLIP-seq
MIRT2200221	hsa-miR-516b	CLIP-seq
MIRT890827	hsa-miR-590-3p	CLIP-seq
MIRT2200223	hsa-miR-622	CLIP-seq

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IDA	17984323
GO:0000776	Component	Kinetochore	IDA	26040712
GO:0000776	Component	Kinetochore	IEA
GO:0000815	Component	ESCRT III complex	IBA
GO:0000815	Component	ESCRT III complex	NAS	36107470
GO:0000815	Component	ESCRT III complex	TAS	20588296
GO:0001778	Process	Plasma membrane repair	IDA	24482116
GO:0001778	Process	Plasma membrane repair	IEA
GO:0005515	Function	Protein binding	IPI	14505570, 14519844, 17711858, 18511562, 18641129, 19302785, 21988832
GO:0005643	Component	Nuclear pore	IDA	26040713
GO:0005643	Component	Nuclear pore	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005765	Component	Lysosomal membrane	IDA	17984323
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IBA
GO:0005828	Component	Kinetochore microtubule	IDA	26040712
GO:0005828	Component	Kinetochore microtubule	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	24878737
GO:0006900	Process	Vesicle budding from membrane	IBA
GO:0006914	Process	Autophagy	IMP	17984323
GO:0006997	Process	Nucleus organization	IMP	20616062
GO:0007034	Process	Vacuolar transport	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	20616062
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0010824	Process	Regulation of centrosome duplication	IMP	20616062
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	TAS	20588296
GO:0030496	Component	Midbody	IDA	22724069, 26040712
GO:0030496	Component	Midbody	IEA
GO:0031468	Process	Nuclear membrane reassembly	IEA
GO:0031468	Process	Nuclear membrane reassembly	IMP	26040713
GO:0031902	Component	Late endosome membrane	IEA
GO:0032466	Process	Negative regulation of cytokinesis	IMP	22422861, 24814515
GO:0032511	Process	Late endosome to vacuole transport via multivesicular body sorting pathway	IBA
GO:0032585	Component	Multivesicular body membrane	IDA	16554368
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0036258	Process	Multivesicular body assembly	IEA
GO:0036258	Process	Multivesicular body assembly	NAS	16505166
GO:0036258	Process	Multivesicular body assembly	TAS	20588296
GO:0039702	Process	Viral budding via host ESCRT complex	IDA	24878737
GO:0039702	Process	Viral budding via host ESCRT complex	IEA
GO:0039702	Process	Viral budding via host ESCRT complex	TAS	20588296
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	14505570, 14519844
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IDA	17984323
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA
GO:0044878	Process	Mitotic cytokinesis checkpoint signaling	IMP	22422861, 24814515
GO:0046761	Process	Viral budding from plasma membrane	IDA	24878737
GO:0046761	Process	Viral budding from plasma membrane	IEA
GO:0046761	Process	Viral budding from plasma membrane	IMP	14505570
GO:0051469	Process	Vesicle fusion with vacuole	NAS	16505166
GO:0061763	Process	Multivesicular body-lysosome fusion	NAS	16505166
GO:0061952	Process	Midbody abscission	IEA
GO:0061952	Process	Midbody abscission	IMP	20616062, 22422861, 24814515
GO:0071985	Process	Multivesicular body sorting pathway	IDA	16554368
GO:0071985	Process	Multivesicular body sorting pathway	IEA
GO:0090148	Process	Membrane fission	NAS	19234443
GO:0090543	Component	Flemming body	IDA	22422861
GO:0090543	Component	Flemming body	IEA
GO:0090611	Process	Ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway	IMP	22547407
GO:0097352	Process	Autophagosome maturation	IEA
GO:0097352	Process	Autophagosome maturation	IMP	17984323
GO:1901673	Process	Regulation of mitotic spindle assembly	IEA
GO:1901673	Process	Regulation of mitotic spindle assembly	IMP	20616062
GO:1902774	Process	Late endosome to lysosome transport	IEA
GO:1902774	Process	Late endosome to lysosome transport	IMP	17984323
GO:1904930	Component	Amphisome membrane	IDA	17984323
GO:1904930	Component	Amphisome membrane	IEA

MIM	HGNC	e!Ensembl
610899	30599	ENSG00000164695

Q96CF2

Protein name

Charged multivesicular body protein 4c (Chromatin-modifying protein 4c) (CHMP4c) (SNF7 homolog associated with Alix 3) (SNF7-3) (hSnf7-3) (Vacuolar protein sorting-associated protein 32-3) (Vps32-3) (hVps32-3)

Protein function

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (IL

PDB

3C3R , 5MK3 , 5V3R , 5WA1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03357	Snf7	24 → 193	Snf7	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, spleen and kidney. {ECO:0000269|PubMed:14583093, ECO:0000269|PubMed:14678797}.

Sequence

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT

Sequence length

233

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Necroptosis		Budding and maturation of HIV virion Macroautophagy Endosomal Sorting Complex Required For Transport (ESCRT) HCMV Late Events Sealing of the nuclear envelope (NE) by ESCRT-III

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	26712741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23535730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23535730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	GWASCAT_DG	25581431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35562678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26712741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26712741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23535730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	23535730, 31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	GWASDB_DG	23535730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28211531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30181294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26712741		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23535730		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	23535730, 31043753		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	23535730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23535730, 31043753	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28211531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28211531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36509838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32406588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHMP4C (charged multivesicular body protein 4C)