CD6 (CD6 molecule)

Gene

• Entrez ID: 923
• Gene name: CD6 molecule
• Gene symbol: CD6
• Synonyms (NCBI Gene): TP120
• Chromosome: 11
• Chromosome location: 11q12.2
• Summary: This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT876092	hsa-let-7a	CLIP-seq
MIRT876093	hsa-let-7b	CLIP-seq
MIRT876094	hsa-let-7c	CLIP-seq
MIRT876095	hsa-let-7d	CLIP-seq
MIRT876096	hsa-let-7e	CLIP-seq
MIRT876097	hsa-let-7f	CLIP-seq
MIRT876098	hsa-let-7g	CLIP-seq
MIRT876099	hsa-let-7i	CLIP-seq
MIRT876100	hsa-miR-103a	CLIP-seq
MIRT876101	hsa-miR-107	CLIP-seq
MIRT876102	hsa-miR-1184	CLIP-seq
MIRT876103	hsa-miR-1226	CLIP-seq
MIRT876104	hsa-miR-1470	CLIP-seq
MIRT876105	hsa-miR-15a	CLIP-seq
MIRT876106	hsa-miR-15b	CLIP-seq
MIRT876107	hsa-miR-16	CLIP-seq
MIRT876108	hsa-miR-1915	CLIP-seq
MIRT876109	hsa-miR-195	CLIP-seq
MIRT876110	hsa-miR-1976	CLIP-seq
MIRT876111	hsa-miR-324-5p	CLIP-seq
MIRT876112	hsa-miR-335	CLIP-seq
MIRT876113	hsa-miR-3622b-5p	CLIP-seq
MIRT876114	hsa-miR-424	CLIP-seq
MIRT876115	hsa-miR-4290	CLIP-seq
MIRT876116	hsa-miR-4458	CLIP-seq
MIRT876117	hsa-miR-4500	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876119	hsa-miR-4720-5p	CLIP-seq
MIRT876120	hsa-miR-4726-3p	CLIP-seq
MIRT876121	hsa-miR-4799-3p	CLIP-seq
MIRT876122	hsa-miR-497	CLIP-seq
MIRT876123	hsa-miR-665	CLIP-seq
MIRT876124	hsa-miR-98	CLIP-seq
MIRT876123	hsa-miR-665	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876100	hsa-miR-103a	CLIP-seq
MIRT876101	hsa-miR-107	CLIP-seq
MIRT876102	hsa-miR-1184	CLIP-seq
MIRT876105	hsa-miR-15a	CLIP-seq
MIRT876106	hsa-miR-15b	CLIP-seq
MIRT876107	hsa-miR-16	CLIP-seq
MIRT876109	hsa-miR-195	CLIP-seq
MIRT876110	hsa-miR-1976	CLIP-seq
MIRT2385754	hsa-miR-296-5p	CLIP-seq
MIRT876114	hsa-miR-424	CLIP-seq
MIRT876115	hsa-miR-4290	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876122	hsa-miR-497	CLIP-seq
MIRT876092	hsa-let-7a	CLIP-seq
MIRT876093	hsa-let-7b	CLIP-seq
MIRT876094	hsa-let-7c	CLIP-seq
MIRT876095	hsa-let-7d	CLIP-seq
MIRT876096	hsa-let-7e	CLIP-seq
MIRT876097	hsa-let-7f	CLIP-seq
MIRT876098	hsa-let-7g	CLIP-seq
MIRT876099	hsa-let-7i	CLIP-seq
MIRT876103	hsa-miR-1226	CLIP-seq
MIRT876112	hsa-miR-335	CLIP-seq
MIRT876116	hsa-miR-4458	CLIP-seq
MIRT876117	hsa-miR-4500	CLIP-seq
MIRT876124	hsa-miR-98	CLIP-seq
MIRT2677759	hsa-miR-3195	CLIP-seq
MIRT2677760	hsa-miR-330-3p	CLIP-seq
MIRT2677761	hsa-miR-4269	CLIP-seq
MIRT2677762	hsa-miR-4514	CLIP-seq
MIRT2677763	hsa-miR-4692	CLIP-seq
MIRT2677764	hsa-miR-4742-5p	CLIP-seq
MIRT2677765	hsa-miR-510	CLIP-seq
MIRT2677766	hsa-miR-518a-3p	CLIP-seq
MIRT2677767	hsa-miR-518b	CLIP-seq
MIRT2677768	hsa-miR-518c	CLIP-seq
MIRT2677769	hsa-miR-518d-3p	CLIP-seq
MIRT2677770	hsa-miR-518f	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Unknown	19446338
RUNX1	Unknown	19446338
RUNX3	Unknown	19446338

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	17601777
GO:0001771	Process	Immunological synapse formation	IMP	15294938
GO:0001772	Component	Immunological synapse	IDA	15294938
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002438	Process	Acute inflammatory response to antigenic stimulus	IDA	17601777
GO:0005515	Function	Protein binding	IPI	24584089, 24945728, 26146185, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	15294938
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1919444
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	16352806
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	17601777
GO:0032496	Process	Response to lipopolysaccharide	IDA	17601777
GO:0042101	Component	T cell receptor complex	IDA	15294938
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	15294938
GO:0042802	Function	Identical protein binding	IPI	26146185
GO:0045087	Process	Innate immune response	IEA
GO:0070891	Function	Lipoteichoic acid binding	IMP	17601777
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	17601777

Other IDs

• MIM: 186720
• HGNC: 1691
• e!Ensembl: ENSG00000013725

Protein

• UniProt ID: P30203
• Protein name: T-cell differentiation antigen CD6 (T12) (TP120) (CD antigen CD6) [Cleaved into: Soluble CD6]
• Protein function: Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed:15048703, PubMed:15294938, PubMed:16352806, PubMed:16914752, PubMed:24584089, PubMed:24945728). Contributes to si
• PDB: 5A2E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00530	SRCR	48 → 156	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	164 → 260	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	268 → 361	Scavenger receptor cysteine-rich domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected on thymocytes (PubMed:15294938). Detected on peripheral blood T-cells (PubMed:15048703, PubMed:16352806). Detected on natural killer (NK) cells (PubMed:16352806). Soluble CD6 is detected in blood serum (at protein level) (PubM
• Sequence:

  MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
  RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
  LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
  EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
  PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
  VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
  SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
  FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
  GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
  NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
  NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
  DYDDISAA

• Sequence length: 668

Pathways

KEGG:

Cell adhesion molecules

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD6-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acampomelic Campomelic Dysplasia	Acampomelic Campomelic Dysplasia	BEFREE	8789441		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10534771, 12124316, 15982341, 8710369		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10354132, 10482981, 10490596, 10573134, 10583273, 10774753, 10914938, 11023523, 11426627, 11529845, 11561155, 11587363, 11726316, 11731441, 11801311, 12124316, 12433682, 12434291, 12506024, 12847317, 14527352, 14574333, 14654544, 14704033, 15114604, 15155899, 15289014, 15749681, 15837750, 15982341, 16157196, 16330447, 16490598, 16531255, 16584381, 16627248, 16912588, 17285576, 17374122, 17418891, 17971484, 18241254, 20930648, 22094584, 22094587, 22173241, 22382891, 22404039, 23741012, 24076604, 26580398, 27215399, 27664585, 28299660, 7492786, 7515661, 7780150, 8558923, 8639909, 8704231, 8757516, 8834231, 8913730, 9163615, 9177434, 9207408, 9234595, 9260053, 9277052, 9305598, 9498702, 9839313		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28724437, 8834231		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	8818662		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23292868		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	28930752		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10482981, 10573134, 10774753, 11023523, 12433682, 12847317, 14527352, 14704033, 15114604, 15155899, 15289014, 15837750, 16330447, 16490598, 16912588, 17285576, 17971484, 20930648, 22094584, 22173241, 22382891, 24076604, 27215399, 7492786, 7515661, 8558923, 8704231, 8913730, 9277052, 9305598, 9498702, 9839313		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30663492		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28234777, 28651520, 28741148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	30199346		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30199346		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10693872, 22685579, 24890719	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35487454	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10583274, 24890719	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16680749		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27108704	Associate	★☆☆☆☆ Found in Text Mining only
Bilateral Periventricular Nodular Heterotopia	Periventricular heterotopia	BEFREE	18384621		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	31842105		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18798222, 29616377		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40391211	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15735016, 16815105		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29381962		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10049061, 10084082, 10198615, 10482981, 10573134, 10774753, 10870481, 10910927, 11023523, 11129441, 11378579, 11699220, 12433682, 12434291, 12621238, 12847317, 14527352, 14704033, 15114604, 15155899, 15217836, 15289014, 15837750, 15967214, 16330447, 16490598, 16627248, 16912588, 16914570, 17285576, 17418891, 17971484, 19813247, 19965625, 20211010, 20930648, 21152005, 21173572, 21960246, 22094584, 22099053, 22173241, 22382891, 23704093, 23853208, 24076604, 24870754, 25893288, 26580398, 27215399, 28500740, 30341373, 31759364, 3258176, 7492786, 7515661, 8558923, 8667657, 8704231, 8751462, 8913730, 9177434, 9226156, 9277052, 9305598, 9389711, 9498702, 9738986, 9839313, 9844930		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	28724437		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	7828142		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11516110, 27393278, 9169030		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	1373311, 1486558, 15104285, 15150091, 16021514, 16285301, 16517477, 16519562, 1797088, 18408594, 27719746, 7493135, 7635565, 7685631, 7828142, 8401579, 8552387, 9422325		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	29095319, 6092990		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28587875, 29530958, 30883299		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29305117, 30169720		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10482981, 11129441, 14527352, 1591704, 16680749, 20107997, 22404039, 24870754, 27215399, 27664585, 3258176, 3395990, 8603366, 9103213, 9233592, 9305591, 9365838		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	29286563, 9811336		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18341091		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 26974007		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31141624		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	7493135		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11023523, 17971484, 9177434		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	36678166	Associate	★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	21536235		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7635565		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	7828142		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	2227952, 2278965, 7533530, 7585464		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16527610		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28396950		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	1967216	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	9209736		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	8603366		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	29351687		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	9234584		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	7492786		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	36159854	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32641083	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	38538213	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	14623459, 29273914		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	16608887		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11106815, 15054823, 16893685, 16912588, 17690704, 19594745, 19665068, 23704093, 27215399, 27341996, 27664585, 30986496, 8704231, 8834231, 9738986		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16818773	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34619772	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10502316, 11867721, 11986246, 12393285, 14654544, 14704033, 15967214, 16912223, 1993309, 28724437, 29273914, 7566973, 8818662, 8834231, 9260053, 9315104		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	29273914		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22099053		★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	11836357		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	10329012, 11890997, 2278965, 24762332, 26202160, 8143274		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	10329012, 11890997, 2278965, 24762332, 26202160, 8143274		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	10914725, 11126370, 20042637, 2372777, 9103213		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	10347549, 10667432, 10809905, 11229517, 11751490, 11802205, 18517278, 18752119, 23958553, 30779112, 7485386, 7493135, 7566973, 7828158, 8143276, 8869802, 8921363, 8976371, 9010102, 9103213, 9306965, 9315104, 9862519		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	21263242		★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	BEFREE	18384621		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159854	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7698223		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	7656198		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	25721125		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	15155899, 16044150, 21628403		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	8143276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18798222, 29616377		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16815105, 29541394, 30557990		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26261659		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16519562, 7685631, 8908164		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31141624		★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	11751490, 1283316, 1344814, 18752119, 7566973, 8913727, 9315104		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	276632, 29851545		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	19525953, 21833088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	19525953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	19525953, 24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19525953, 19825846, 19865102, 21552549, 23638056, 24890719, 36451826	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21849685, 26844569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	19525953, 24076602		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11867721, 28113084, 29273914, 30825516, 7731705		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	16810199, 7731705, 9763573		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	14654544, 2332039, 3030534, 9365838		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	11229517, 18752119, 23958553, 7493135, 7566973, 8143276, 8976371, 9306965, 9862519		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10347549, 10398424, 11890997, 1458446, 14695177, 16815105, 17255779, 1993305, 22226016, 2268579, 24145651, 27215399, 29199465, 29273914, 30779112, 3355995, 7601452, 7685631, 7828158, 8040301, 9585056		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	1956058		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	9103213		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	24130718	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	29395691		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24888801, 27349192, 28716553, 29968187		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28356114		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	BEFREE	28513869, 30413451		★☆☆☆☆ Found in Text Mining only
Pharyngitis	Pharyngitis	BEFREE	31735631		★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	30422774		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	12216069, 14695177, 20018915		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	28724437		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10914546, 11426627, 11841400, 12626745, 16044150, 19264230, 28724437, 9233588		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17434765, 27607436		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10482981, 11561155, 11731441, 11801311, 12124316, 12506024, 14654544, 15749681, 16157196, 16584381, 16627248, 17374122, 17418891, 22094587, 23741012, 26580398, 27215399, 27664585, 7492786, 7515661, 7780150, 8558923, 9177434, 9234595, 9260053		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21914494		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	39390078	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35767366	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	24890719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	29048238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	9460503		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19389237, 24449571, 26844569		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	28781197		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	7685631, 7828142, 8143276, 8869802		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	12661008		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	31842105		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22226016		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36378845	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20107997		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36253349	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly, type 2	Syndactyly	BEFREE	9730609		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	26864698, 29305117, 31228704		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	6711615		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	BEFREE	10565301, 11788889, 11904348, 17045619, 2227952, 22343407, 2278965, 2397453, 2702616, 7533530, 7585464, 7601452, 9585056, 9740667, 9824210, 9892177		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	7656198		★☆☆☆☆ Found in Text Mining only