Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9228
Gene name	DLG associated protein 2
Gene symbol	DLGAP2
Synonyms (NCBI Gene)	C8orf68DAP2ERICH1-AS1SAPAP2
Chromosome	8
Chromosome location	8p23.3
Summary	The product of this gene is a membrane-associated protein that may play a role in synapse organization and signalling in neuronal cells. This gene is biallelically expressed in the brain, however, only the paternal allele is expressed in the testis (PMID:

197

Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT716570	hsa-miR-4635	HITS-CLIP	19536157
MIRT716569	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT716568	hsa-miR-4764-5p	HITS-CLIP	19536157
MIRT716567	hsa-miR-526b-5p	HITS-CLIP	19536157
MIRT716566	hsa-miR-578	HITS-CLIP	19536157
MIRT716570	hsa-miR-4635	HITS-CLIP	19536157
MIRT716569	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT716568	hsa-miR-4764-5p	HITS-CLIP	19536157
MIRT716567	hsa-miR-526b-5p	HITS-CLIP	19536157
MIRT716566	hsa-miR-578	HITS-CLIP	19536157
MIRT658992	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT658991	hsa-miR-544a	HITS-CLIP	23824327
MIRT658990	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT716570	hsa-miR-4635	HITS-CLIP	19536157
MIRT716569	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT716568	hsa-miR-4764-5p	HITS-CLIP	19536157
MIRT716567	hsa-miR-526b-5p	HITS-CLIP	19536157
MIRT716566	hsa-miR-578	HITS-CLIP	19536157
MIRT716570	hsa-miR-4635	HITS-CLIP	19536157
MIRT716569	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT716568	hsa-miR-4764-5p	HITS-CLIP	19536157
MIRT716567	hsa-miR-526b-5p	HITS-CLIP	19536157
MIRT716566	hsa-miR-578	HITS-CLIP	19536157
MIRT658992	hsa-miR-20a-3p	HITS-CLIP	23824327
MIRT658991	hsa-miR-544a	HITS-CLIP	23824327
MIRT658990	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT938504	hsa-miR-1197	CLIP-seq
MIRT938505	hsa-miR-1207-3p	CLIP-seq
MIRT938506	hsa-miR-1253	CLIP-seq
MIRT938507	hsa-miR-1258	CLIP-seq
MIRT938508	hsa-miR-1290	CLIP-seq
MIRT938509	hsa-miR-1291	CLIP-seq
MIRT938510	hsa-miR-129-5p	CLIP-seq
MIRT938511	hsa-miR-1305	CLIP-seq
MIRT740097	hsa-miR-132	CLIP-seq
MIRT938512	hsa-miR-134	CLIP-seq
MIRT938513	hsa-miR-138	CLIP-seq
MIRT938514	hsa-miR-146a	CLIP-seq
MIRT938515	hsa-miR-146b-5p	CLIP-seq
MIRT938516	hsa-miR-1470	CLIP-seq
MIRT938517	hsa-miR-153	CLIP-seq
MIRT938518	hsa-miR-1912	CLIP-seq
MIRT938519	hsa-miR-194	CLIP-seq
MIRT938520	hsa-miR-196a	CLIP-seq
MIRT938521	hsa-miR-196b	CLIP-seq
MIRT938522	hsa-miR-2110	CLIP-seq
MIRT938523	hsa-miR-2115	CLIP-seq
MIRT740096	hsa-miR-212	CLIP-seq
MIRT938524	hsa-miR-25	CLIP-seq
MIRT938525	hsa-miR-299-3p	CLIP-seq
MIRT938526	hsa-miR-3074-3p	CLIP-seq
MIRT938527	hsa-miR-3117-3p	CLIP-seq
MIRT938528	hsa-miR-3118	CLIP-seq
MIRT938529	hsa-miR-3120-3p	CLIP-seq
MIRT938530	hsa-miR-3123	CLIP-seq
MIRT938531	hsa-miR-3130-5p	CLIP-seq
MIRT740095	hsa-miR-3140-3p	CLIP-seq
MIRT938532	hsa-miR-3151	CLIP-seq
MIRT938533	hsa-miR-3153	CLIP-seq
MIRT938534	hsa-miR-3163	CLIP-seq
MIRT938535	hsa-miR-3173-5p	CLIP-seq
MIRT938536	hsa-miR-3185	CLIP-seq
MIRT938537	hsa-miR-3194-3p	CLIP-seq
MIRT938538	hsa-miR-32	CLIP-seq
MIRT938539	hsa-miR-33a	CLIP-seq
MIRT938540	hsa-miR-33b	CLIP-seq
MIRT938541	hsa-miR-3622a-3p	CLIP-seq
MIRT938542	hsa-miR-3622b-3p	CLIP-seq
MIRT938543	hsa-miR-363	CLIP-seq
MIRT938544	hsa-miR-3655	CLIP-seq
MIRT938545	hsa-miR-367	CLIP-seq
MIRT938546	hsa-miR-370	CLIP-seq
MIRT938547	hsa-miR-371-5p	CLIP-seq
MIRT938548	hsa-miR-371b-5p	CLIP-seq
MIRT938549	hsa-miR-380	CLIP-seq
MIRT938550	hsa-miR-3924	CLIP-seq
MIRT938551	hsa-miR-3927	CLIP-seq
MIRT938552	hsa-miR-3936	CLIP-seq
MIRT938553	hsa-miR-4271	CLIP-seq
MIRT938554	hsa-miR-4290	CLIP-seq
MIRT938555	hsa-miR-4293	CLIP-seq
MIRT938556	hsa-miR-4299	CLIP-seq
MIRT938557	hsa-miR-4312	CLIP-seq
MIRT938558	hsa-miR-4325	CLIP-seq
MIRT938559	hsa-miR-4328	CLIP-seq
MIRT938560	hsa-miR-4418	CLIP-seq
MIRT938561	hsa-miR-4444	CLIP-seq
MIRT938562	hsa-miR-4446-3p	CLIP-seq
MIRT938563	hsa-miR-4447	CLIP-seq
MIRT938564	hsa-miR-4452	CLIP-seq
MIRT938565	hsa-miR-4472	CLIP-seq
MIRT938566	hsa-miR-4477a	CLIP-seq
MIRT938567	hsa-miR-4477b	CLIP-seq
MIRT938568	hsa-miR-448	CLIP-seq
MIRT938569	hsa-miR-4482	CLIP-seq
MIRT938570	hsa-miR-4490	CLIP-seq
MIRT938571	hsa-miR-4492	CLIP-seq
MIRT938572	hsa-miR-4495	CLIP-seq
MIRT938573	hsa-miR-4498	CLIP-seq
MIRT938574	hsa-miR-4503	CLIP-seq
MIRT938575	hsa-miR-4505	CLIP-seq
MIRT938576	hsa-miR-450b-5p	CLIP-seq
MIRT938577	hsa-miR-4646-5p	CLIP-seq
MIRT938578	hsa-miR-4650-3p	CLIP-seq
MIRT938579	hsa-miR-4654	CLIP-seq
MIRT938580	hsa-miR-4668-5p	CLIP-seq
MIRT938581	hsa-miR-4686	CLIP-seq
MIRT938582	hsa-miR-4687-3p	CLIP-seq
MIRT938583	hsa-miR-4687-5p	CLIP-seq
MIRT938584	hsa-miR-4714-3p	CLIP-seq
MIRT938585	hsa-miR-4721	CLIP-seq
MIRT938586	hsa-miR-4725-3p	CLIP-seq
MIRT938587	hsa-miR-4731-3p	CLIP-seq
MIRT938588	hsa-miR-4760-3p	CLIP-seq
MIRT938589	hsa-miR-4769-5p	CLIP-seq
MIRT938590	hsa-miR-4774-5p	CLIP-seq
MIRT938591	hsa-miR-4795-5p	CLIP-seq
MIRT938592	hsa-miR-4801	CLIP-seq
MIRT938593	hsa-miR-4803	CLIP-seq
MIRT938594	hsa-miR-491-5p	CLIP-seq
MIRT938595	hsa-miR-496	CLIP-seq
MIRT938596	hsa-miR-498	CLIP-seq
MIRT938597	hsa-miR-507	CLIP-seq
MIRT938598	hsa-miR-509-3-5p	CLIP-seq
MIRT938599	hsa-miR-5095	CLIP-seq
MIRT938600	hsa-miR-509-5p	CLIP-seq
MIRT938601	hsa-miR-513c	CLIP-seq
MIRT938602	hsa-miR-514b-5p	CLIP-seq
MIRT938603	hsa-miR-532-5p	CLIP-seq
MIRT938604	hsa-miR-543	CLIP-seq
MIRT938605	hsa-miR-548a-3p	CLIP-seq
MIRT938606	hsa-miR-548an	CLIP-seq
MIRT938607	hsa-miR-548c-3p	CLIP-seq
MIRT938608	hsa-miR-548e	CLIP-seq
MIRT938609	hsa-miR-548f	CLIP-seq
MIRT938610	hsa-miR-557	CLIP-seq
MIRT938611	hsa-miR-580	CLIP-seq
MIRT938612	hsa-miR-582-5p	CLIP-seq
MIRT938613	hsa-miR-589	CLIP-seq
MIRT938614	hsa-miR-596	CLIP-seq
MIRT938615	hsa-miR-600	CLIP-seq
MIRT938616	hsa-miR-671-5p	CLIP-seq
MIRT938617	hsa-miR-762	CLIP-seq
MIRT938618	hsa-miR-767-3p	CLIP-seq
MIRT938619	hsa-miR-889	CLIP-seq
MIRT938620	hsa-miR-92a	CLIP-seq
MIRT938621	hsa-miR-92b	CLIP-seq
MIRT938587	hsa-miR-4731-3p	CLIP-seq
MIRT938592	hsa-miR-4801	CLIP-seq
MIRT1556227	hsa-miR-1909	CLIP-seq
MIRT938504	hsa-miR-1197	CLIP-seq
MIRT938510	hsa-miR-129-5p	CLIP-seq
MIRT938511	hsa-miR-1305	CLIP-seq
MIRT1977687	hsa-miR-181a	CLIP-seq
MIRT1977688	hsa-miR-181b	CLIP-seq
MIRT1977689	hsa-miR-181c	CLIP-seq
MIRT1977690	hsa-miR-181d	CLIP-seq
MIRT1977691	hsa-miR-205	CLIP-seq
MIRT938522	hsa-miR-2110	CLIP-seq
MIRT938534	hsa-miR-3163	CLIP-seq
MIRT938539	hsa-miR-33a	CLIP-seq
MIRT938540	hsa-miR-33b	CLIP-seq
MIRT1977692	hsa-miR-4262	CLIP-seq
MIRT1977693	hsa-miR-4428	CLIP-seq
MIRT1977694	hsa-miR-4481	CLIP-seq
MIRT938571	hsa-miR-4492	CLIP-seq
MIRT938573	hsa-miR-4498	CLIP-seq
MIRT938575	hsa-miR-4505	CLIP-seq
MIRT938576	hsa-miR-450b-5p	CLIP-seq
MIRT1977695	hsa-miR-4745-5p	CLIP-seq
MIRT938596	hsa-miR-498	CLIP-seq
MIRT938597	hsa-miR-507	CLIP-seq
MIRT1977696	hsa-miR-520a-5p	CLIP-seq
MIRT1977697	hsa-miR-525-5p	CLIP-seq
MIRT938610	hsa-miR-557	CLIP-seq
MIRT938617	hsa-miR-762	CLIP-seq
MIRT1977698	hsa-miR-873	CLIP-seq
MIRT938511	hsa-miR-1305	CLIP-seq
MIRT2213005	hsa-miR-1915	CLIP-seq
MIRT2213006	hsa-miR-28-5p	CLIP-seq
MIRT2213007	hsa-miR-3139	CLIP-seq
MIRT2213008	hsa-miR-3159	CLIP-seq
MIRT938539	hsa-miR-33a	CLIP-seq
MIRT938540	hsa-miR-33b	CLIP-seq
MIRT2213009	hsa-miR-3670	CLIP-seq
MIRT2213010	hsa-miR-3689d	CLIP-seq
MIRT2213011	hsa-miR-4726-3p	CLIP-seq
MIRT2213012	hsa-miR-665	CLIP-seq
MIRT2213013	hsa-miR-708	CLIP-seq
MIRT1977698	hsa-miR-873	CLIP-seq
MIRT938576	hsa-miR-450b-5p	CLIP-seq
MIRT938597	hsa-miR-507	CLIP-seq
MIRT938604	hsa-miR-543	CLIP-seq
MIRT938610	hsa-miR-557	CLIP-seq
MIRT2386938	hsa-miR-7	CLIP-seq
MIRT2436864	hsa-miR-4453	CLIP-seq
MIRT2436865	hsa-miR-4538	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17474147, 25416956, 29892012, 32296183, 32814053
GO:0005883	Component	Neurofilament	NAS	10759891
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007270	Process	Neuron-neuron synaptic transmission	NAS
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0045202	Component	Synapse	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0099572	Component	Postsynaptic specialization	IBA

MIM	HGNC	e!Ensembl
605438	2906	ENSG00000198010

Q9P1A6

Protein name

Disks large-associated protein 2 (DAP-2) (PSD-95/SAP90-binding protein 2) (SAP90/PSD-95-associated protein 2) (SAPAP2)

Protein function

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03359	GKAP	709 → 1054	Guanylate-kinase-associated protein (GKAP) protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and kidney.

Sequence

MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEAGDLVQPGISFPGPAEEDLDPQY
SWSPTQHFNEERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYL
LSPADSCPGGRHRCSPRSSVHSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHA
GAKINRIPANLLDQFEKQLPLHRDGFHTLQYQRTSAAAEQRSESPGRIRHLVHSVQKLFT
KSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSKERKPEGKPRPGMSSWWSSDD
NLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTP
DAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPT
GGKDEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPKSAILPEPLLKSIGQRPLGEHQT
QTYLQAASDVPVGHSLDPAANYNSPKFRSRNQSYMRAVSTLSQASCVSQVSEAEINGQFE
SVCESVFSEVESQAMDALDLPGCFRTRSHSYLRAIQAGYSQDDECIPMMTPSDITSTIRS
TAAVSYTNYKKTPPPVPPRTTSKPLISVTAQSSTESTQDAYQDSRAQRMSPWPQDSRGLY
NSTDSLDSNKAMNLALETAAAQRHLPESQSSSVRTSDKAILVSKAEELLKSRCSSIGIQD
SEFPEHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSNSVTAAVQADL
ELEGFPGHITTEDKGLQFGSSFQRHSEPSTPTQYSAVRTVRTQGLFSYREDYRTQVDTST
LPPPDPWLEPAIDTVETGRMSPCRRDGSWFLKLLHAETKRMEGWCKEMEREAEENDLSEE
ILGKIRSAVGSAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSIEDVSM
KFDELQRLRLNDWKMMESPERKEERKVPPPIPKKPPKGKFPITREKSLDLPDRQRQEARR
RLMAAKRAASFRQNSASERADSIEIYIPEAQTRL

Sequence length

1054

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DLGAP2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	25391383, 32877673	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	27271353, 30392976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	20531469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20531469, 28407363	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	28407363, 31451081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37628841, 38003265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASCAT_DG	29885931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32877673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28901431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34116986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29518789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28901431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34116986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	19793310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29885931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	15030493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26393913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	32877673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	28901431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26393913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Northern epilepsy syndrome	Northern epilepsy syndrome	BEFREE	10854099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	31095341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24416398, 30504779		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24416398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27271353, 30504779	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18055845	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

DLGAP2 (DLG associated protein 2)