MAGI1 (membrane associated guanylate kinase, WW and PDZ domain containing 1)

Gene

• Entrez ID: 9223
• Gene name: Membrane associated guanylate kinase, WW and PDZ domain containing 1
• Gene symbol: MAGI1
• Synonyms (NCBI Gene): AIP-3, AIP3, BAIAP1, BAP-1, BAP1, MAGI-1, MAGI-1b, Magi1d, TNRC19, WWP3
• Chromosome: 3
• Chromosome location: 3p14.1
• Summary: The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell con

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017415	hsa-miR-335-5p	Microarray	18185580
MIRT025370	hsa-miR-34a-5p	Sequencing	20371350
MIRT030459	hsa-miR-24-3p	Sequencing	20371350
MIRT042831	hsa-miR-324-3p	CLASH	23622248
MIRT1125832	hsa-miR-101	CLIP-seq
MIRT1125833	hsa-miR-1179	CLIP-seq
MIRT1125834	hsa-miR-1272	CLIP-seq
MIRT1125835	hsa-miR-1292	CLIP-seq
MIRT1125836	hsa-miR-1321	CLIP-seq
MIRT1125837	hsa-miR-139-5p	CLIP-seq
MIRT1125838	hsa-miR-140-3p	CLIP-seq
MIRT1125839	hsa-miR-140-5p	CLIP-seq
MIRT1125840	hsa-miR-142-3p	CLIP-seq
MIRT1125841	hsa-miR-144	CLIP-seq
MIRT1125842	hsa-miR-1470	CLIP-seq
MIRT1125843	hsa-miR-1827	CLIP-seq
MIRT1125844	hsa-miR-186	CLIP-seq
MIRT1125845	hsa-miR-1914	CLIP-seq
MIRT1125846	hsa-miR-2054	CLIP-seq
MIRT1125847	hsa-miR-224	CLIP-seq
MIRT1125848	hsa-miR-24	CLIP-seq
MIRT1125849	hsa-miR-2682	CLIP-seq
MIRT1125850	hsa-miR-27a	CLIP-seq
MIRT1125851	hsa-miR-27b	CLIP-seq
MIRT1125852	hsa-miR-298	CLIP-seq
MIRT1125853	hsa-miR-3123	CLIP-seq
MIRT1125854	hsa-miR-3145-3p	CLIP-seq
MIRT1125855	hsa-miR-3155	CLIP-seq
MIRT1125856	hsa-miR-3155b	CLIP-seq
MIRT1125857	hsa-miR-3160-5p	CLIP-seq
MIRT1125858	hsa-miR-3163	CLIP-seq
MIRT1125859	hsa-miR-3189-5p	CLIP-seq
MIRT1125860	hsa-miR-320a	CLIP-seq
MIRT1125861	hsa-miR-320b	CLIP-seq
MIRT1125862	hsa-miR-320c	CLIP-seq
MIRT1125863	hsa-miR-320d	CLIP-seq
MIRT1125864	hsa-miR-34c-3p	CLIP-seq
MIRT1125865	hsa-miR-3545-5p	CLIP-seq
MIRT1125866	hsa-miR-3613-3p	CLIP-seq
MIRT1125867	hsa-miR-3662	CLIP-seq
MIRT1125868	hsa-miR-3671	CLIP-seq
MIRT1125869	hsa-miR-3682-3p	CLIP-seq
MIRT1125870	hsa-miR-376a	CLIP-seq
MIRT1125871	hsa-miR-376b	CLIP-seq
MIRT1125872	hsa-miR-380	CLIP-seq
MIRT1125873	hsa-miR-3925-5p	CLIP-seq
MIRT1125874	hsa-miR-421	CLIP-seq
MIRT1125875	hsa-miR-4253	CLIP-seq
MIRT1125876	hsa-miR-4272	CLIP-seq
MIRT1125877	hsa-miR-4284	CLIP-seq
MIRT1125878	hsa-miR-4323	CLIP-seq
MIRT1125879	hsa-miR-4429	CLIP-seq
MIRT1125880	hsa-miR-4436b-5p	CLIP-seq
MIRT1125881	hsa-miR-4438	CLIP-seq
MIRT1125882	hsa-miR-4446-5p	CLIP-seq
MIRT1125883	hsa-miR-4460	CLIP-seq
MIRT1125884	hsa-miR-4471	CLIP-seq
MIRT1125885	hsa-miR-449c	CLIP-seq
MIRT1125886	hsa-miR-450b-3p	CLIP-seq
MIRT1125887	hsa-miR-4645-3p	CLIP-seq
MIRT1125888	hsa-miR-4648	CLIP-seq
MIRT1125889	hsa-miR-4654	CLIP-seq
MIRT1125890	hsa-miR-4667-3p	CLIP-seq
MIRT1125891	hsa-miR-4709-5p	CLIP-seq
MIRT1125892	hsa-miR-4713-3p	CLIP-seq
MIRT1125893	hsa-miR-4718	CLIP-seq
MIRT1125894	hsa-miR-4728-5p	CLIP-seq
MIRT1125895	hsa-miR-4739	CLIP-seq
MIRT1125896	hsa-miR-4755-5p	CLIP-seq
MIRT1125897	hsa-miR-4756-5p	CLIP-seq
MIRT1125898	hsa-miR-4769-5p	CLIP-seq
MIRT1125899	hsa-miR-484	CLIP-seq
MIRT1125900	hsa-miR-499-3p	CLIP-seq
MIRT1125901	hsa-miR-499a-3p	CLIP-seq
MIRT1125902	hsa-miR-499a-5p	CLIP-seq
MIRT1125903	hsa-miR-503	CLIP-seq
MIRT1125904	hsa-miR-513a-5p	CLIP-seq
MIRT1125905	hsa-miR-548ae	CLIP-seq
MIRT1125906	hsa-miR-548aj	CLIP-seq
MIRT1125907	hsa-miR-548am	CLIP-seq
MIRT1125908	hsa-miR-548x	CLIP-seq
MIRT1125909	hsa-miR-551a	CLIP-seq
MIRT1125910	hsa-miR-551b	CLIP-seq
MIRT1125911	hsa-miR-582-5p	CLIP-seq
MIRT1125912	hsa-miR-600	CLIP-seq
MIRT1125913	hsa-miR-638	CLIP-seq
MIRT1125914	hsa-miR-642a	CLIP-seq
MIRT1125915	hsa-miR-664	CLIP-seq
MIRT1125916	hsa-miR-769-3p	CLIP-seq
MIRT1125917	hsa-miR-940	CLIP-seq
MIRT1125834	hsa-miR-1272	CLIP-seq
MIRT1125918	hsa-miR-3663-3p	CLIP-seq
MIRT1125919	hsa-miR-433	CLIP-seq
MIRT1125920	hsa-miR-4646-5p	CLIP-seq
MIRT1125874	hsa-miR-421	CLIP-seq
MIRT1125891	hsa-miR-4709-5p	CLIP-seq
MIRT1125832	hsa-miR-101	CLIP-seq
MIRT1125833	hsa-miR-1179	CLIP-seq
MIRT2035547	hsa-miR-1228	CLIP-seq
MIRT2035548	hsa-miR-1245b-3p	CLIP-seq
MIRT2035549	hsa-miR-125a-3p	CLIP-seq
MIRT2035550	hsa-miR-1271	CLIP-seq
MIRT2035551	hsa-miR-1273d	CLIP-seq
MIRT1125842	hsa-miR-1470	CLIP-seq
MIRT2035552	hsa-miR-182	CLIP-seq
MIRT1125846	hsa-miR-2054	CLIP-seq
MIRT1125847	hsa-miR-224	CLIP-seq
MIRT1125850	hsa-miR-27a	CLIP-seq
MIRT1125851	hsa-miR-27b	CLIP-seq
MIRT2035553	hsa-miR-3074-3p	CLIP-seq
MIRT1125855	hsa-miR-3155	CLIP-seq
MIRT1125856	hsa-miR-3155b	CLIP-seq
MIRT2035554	hsa-miR-3157-5p	CLIP-seq
MIRT1125860	hsa-miR-320a	CLIP-seq
MIRT1125861	hsa-miR-320b	CLIP-seq
MIRT1125862	hsa-miR-320c	CLIP-seq
MIRT1125863	hsa-miR-320d	CLIP-seq
MIRT2035555	hsa-miR-331-5p	CLIP-seq
MIRT2035556	hsa-miR-342-3p	CLIP-seq
MIRT1125867	hsa-miR-3662	CLIP-seq
MIRT1125868	hsa-miR-3671	CLIP-seq
MIRT1125870	hsa-miR-376a	CLIP-seq
MIRT1125871	hsa-miR-376b	CLIP-seq
MIRT1125872	hsa-miR-380	CLIP-seq
MIRT2035557	hsa-miR-3934	CLIP-seq
MIRT2035558	hsa-miR-3977	CLIP-seq
MIRT2035559	hsa-miR-4269	CLIP-seq
MIRT1125877	hsa-miR-4284	CLIP-seq
MIRT1125879	hsa-miR-4429	CLIP-seq
MIRT1125882	hsa-miR-4446-5p	CLIP-seq
MIRT1125887	hsa-miR-4645-3p	CLIP-seq
MIRT2035560	hsa-miR-4661-3p	CLIP-seq
MIRT1125890	hsa-miR-4667-3p	CLIP-seq
MIRT1125891	hsa-miR-4709-5p	CLIP-seq
MIRT2035561	hsa-miR-4733-3p	CLIP-seq
MIRT1125896	hsa-miR-4755-5p	CLIP-seq
MIRT2035562	hsa-miR-4762-3p	CLIP-seq
MIRT2035563	hsa-miR-4796-5p	CLIP-seq
MIRT1125899	hsa-miR-484	CLIP-seq
MIRT1125900	hsa-miR-499-3p	CLIP-seq
MIRT1125901	hsa-miR-499a-3p	CLIP-seq
MIRT1125902	hsa-miR-499a-5p	CLIP-seq
MIRT1125904	hsa-miR-513a-5p	CLIP-seq
MIRT2035564	hsa-miR-518a-5p	CLIP-seq
MIRT2035565	hsa-miR-527	CLIP-seq
MIRT2035566	hsa-miR-561	CLIP-seq
MIRT2035567	hsa-miR-568	CLIP-seq
MIRT2035568	hsa-miR-586	CLIP-seq
MIRT2035569	hsa-miR-607	CLIP-seq
MIRT1125914	hsa-miR-642a	CLIP-seq
MIRT1125915	hsa-miR-664	CLIP-seq
MIRT2035570	hsa-miR-764	CLIP-seq
MIRT2035571	hsa-miR-96	CLIP-seq
MIRT1125832	hsa-miR-101	CLIP-seq
MIRT1125841	hsa-miR-144	CLIP-seq
MIRT2266058	hsa-miR-148a	CLIP-seq
MIRT2266059	hsa-miR-148b	CLIP-seq
MIRT2266060	hsa-miR-152	CLIP-seq
MIRT2266061	hsa-miR-323-3p	CLIP-seq
MIRT2266062	hsa-miR-4659a-5p	CLIP-seq
MIRT2266063	hsa-miR-4659b-5p	CLIP-seq
MIRT2266064	hsa-miR-4776-3p	CLIP-seq
MIRT1125911	hsa-miR-582-5p	CLIP-seq
MIRT1125832	hsa-miR-101	CLIP-seq
MIRT1125841	hsa-miR-144	CLIP-seq
MIRT2266061	hsa-miR-323-3p	CLIP-seq
MIRT1125911	hsa-miR-582-5p	CLIP-seq
MIRT1125838	hsa-miR-140-3p	CLIP-seq
MIRT1125844	hsa-miR-186	CLIP-seq
MIRT1125845	hsa-miR-1914	CLIP-seq
MIRT2565327	hsa-miR-193a-5p	CLIP-seq
MIRT1125866	hsa-miR-3613-3p	CLIP-seq
MIRT2565328	hsa-miR-4489	CLIP-seq
MIRT2565329	hsa-miR-4506	CLIP-seq
MIRT2565330	hsa-miR-4508	CLIP-seq
MIRT1125886	hsa-miR-450b-3p	CLIP-seq
MIRT2565331	hsa-miR-4532	CLIP-seq
MIRT1125888	hsa-miR-4648	CLIP-seq
MIRT1125889	hsa-miR-4654	CLIP-seq
MIRT1125892	hsa-miR-4713-3p	CLIP-seq
MIRT1125898	hsa-miR-4769-5p	CLIP-seq
MIRT2565332	hsa-miR-548c-3p	CLIP-seq
MIRT1125909	hsa-miR-551a	CLIP-seq
MIRT1125910	hsa-miR-551b	CLIP-seq
MIRT1125913	hsa-miR-638	CLIP-seq
MIRT1125916	hsa-miR-769-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001886	Process	Endothelial cell morphogenesis	ISS
GO:0005515	Function	Protein binding	IPI	9647693, 11168587, 12097473, 12444549, 14627983, 16464232, 17267502, 22662192, 22898364, 23873930, 32296183, 33208464, 33961781, 37100772
GO:0005515	Function	Protein binding	TAS	9647739
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16464232, 20298433
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	20298433
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9647739
GO:0005911	Component	Cell-cell junction	IBA
GO:0005911	Component	Cell-cell junction	IDA	20298433
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	TAS	9647739
GO:0005912	Component	Adherens junction	ISS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007155	Process	Cell adhesion	TAS	9647739
GO:0007165	Process	Signal transduction	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9647739
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	20298433
GO:0030054	Component	Cell junction	IDA
GO:0042995	Component	Cell projection	IDA	16464232
GO:0051393	Function	Alpha-actinin binding	IPI	16464232
GO:0065003	Process	Protein-containing complex assembly	NAS	9647739
GO:0070161	Component	Anchoring junction	IEA
GO:0071944	Component	Cell periphery	IDA	20298433

Other IDs

• MIM: 602625
• HGNC: 946
• e!Ensembl: ENSG00000151276

Protein

• UniProt ID: Q96QZ7
• Protein name: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (Atrophin-1-interacting protein 3) (AIP-3) (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) (Trinucleotide repeat-containing gene 19
• Protein function: Plays a role in coupling actin fibers to cell junctions in endothelial cells, via its interaction with AMOTL2 and CDH5 (By similarity). May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface (By similarity). {E
• PDB: 1WBP, 2KPK, 2KPL, 2Q9V, 2R4H, 2YSD, 2YSE, 2ZAJ, 3BPU, 5N7D, 5N7F, 5N7G, 6TWU, 6TWX, 6TWY, 7P71
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00625	Guanylate_kin	126 → 200	Guanylate kinase	Domain
  PF16663	MAGI_u1	202 → 261		Disordered
  PF00397	WW	302 → 331	WW domain	Domain
  PF00397	WW	361 → 390	WW domain	Domain
  PF00595	PDZ	472 → 552	PDZ domain	Domain
  PF00595	PDZ	642 → 720	PDZ domain	Domain
  PF16666	MAGI_u5	722 → 840		Disordered
  PF00595	PDZ	841 → 922	PDZ domain	Domain
  PF00595	PDZ	998 → 1091	PDZ domain	Domain
  PF00595	PDZ	1152 → 1231	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with the exception of skeletal muscle. Isoform 1, isoform 2 and isoform 6 are highly expressed in colon, kidney, lung, liver, and pancreas. Isoform 5 is predominantly expressed in brain and heart. Isoform 3 and isoform
• Sequence:

  MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGE
  GPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
  QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVG
  TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE
  EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLG
  PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
  LPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ
  QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSR
  GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ
  SIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTG
  KVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADS
  PGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQ
  RGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQ
  TDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ
  DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKS
  HQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQ
  GSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRP
  EAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIK
  EAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFK
  APQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEIL
  EINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR
  AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDS
  GACRPKDRAPEGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSP
  ERRRERSPTRRRDGSPSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRR
  ERSLDKRNREDRASHREREEANLKQDAGRSSRHPPEQRRRPYKECSTDLSI

• Sequence length: 1491

Pathways

KEGG:

Rap1 signaling pathway
PI3K-Akt signaling pathway
Tight junction
Human papillomavirus infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ILEOCOLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIANAL CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	27984124, 30156768, 30354850		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30716094		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27553041, 27984124		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	28488170		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26717940, 26839173, 28662997, 31734934		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29061454		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	38056214	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	24076305		★☆☆☆☆ Found in Text Mining only
Angioblastic Meningioma	Angioblastic Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25184537		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	25080371		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	34987644	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	31122820	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30395583		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	30395583, 32012241, 34145795	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27352265		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16341802, 18949367, 19197335, 23664488, 25225064, 25658628, 26419610, 26748926, 27834213, 28121081, 28159633, 28170043, 28482042, 28551647, 29206651, 30076753, 30716094, 9528852		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22889334, 24243779, 25225064, 26022455, 26191197, 26409435, 26419610, 28170043, 29528717, 30716094, 35381901, 36754982	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	25753955	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	12800201		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	31706282, 37607989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27813512, 28614305, 37543638	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29166932	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26022455, 26900815, 27223342, 29802871		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	29528717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26409435, 28062663, 34227091	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22997493, 29018224, 29528717, 29778232, 31862487, 35898502	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	26743471, 26981779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	28327999	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27352265		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25970771, 26885612, 27114369, 29088836, 30377796, 9528852		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24293293, 25184537, 26982343, 29778232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22683710, 34591877	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23036577, 23333114, 23620406, 23684012, 23709298, 23867514, 24029645, 24158655, 24243779, 24382589, 24821879, 25124064, 25465300, 25826081, 26111976, 26300218, 26452128, 26484545, 26864202, 27556922, 27713405, 28062663, 28212566, 28327121, 28408295, 28459210, 28618948, 28731045, 28753773, 28779136, 29118224, 29132830, 29528717, 29617669, 29978187, 30135306, 30277889, 30416077, 30477459, 30660076, 30814637, 30886153, 31034483, 31706282, 32029730, 32251007, 32944962, 33062672, 33121461, 33529461, 33547292, 33664427, 33668731, 34227091, 34439859, 34628055, 34767027, 35444164, 35483881, 35576287, 35686121, 35886066, 35918352, 35945149, 35995140, 36505457, 36562826, 36754982, 36917021, 36973268, 37074911, 37515929, 37607989, 37864521, 38456787, 39672382	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25080371, 25225168, 25972334, 26719535, 28062663, 30578689		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	CLINVAR_DG	25687217		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	CTD_human_DG	26719535		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	9528852		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	26900815		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	31713897		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	29891723		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms, Primary	Central Nervous System Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Cerebral Convexity Meningioma	Cerebral Convexity Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29159179		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29159179		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29061454		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509, 25231345		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24185509, 24243779, 24867389, 25536104, 26982343, 28122578, 29778232, 29848569, 30170977, 31122820, 32293336, 32641744, 33093002, 33200197, 33529461, 33579226, 34608257, 34810298, 34987644, 35986087, 36462464, 37184679	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25830670, 28122578, 28618948, 31130514, 31382694		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26765459, 30305612	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	29778232	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Clear Cell Meningioma	Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	22683710, 23709298, 24029645, 26854086, 29708949, 29853346, 30814637		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30716094		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30716094, 39984049	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33529461, 36356413, 36754982, 39984049	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28444874		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24185513, 25536104, 25693006, 28122578		★☆☆☆☆ Found in Text Mining only
Congenital lamellar cataract	Congenital Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22683710, 22949125, 23333114, 23620406, 23644518, 23709298, 23832661, 23867514, 24029645, 24076305, 24158655, 24166983, 24243779, 24382589, 25087671, 25359211, 25465300, 25479927, 25873528, 26166446, 26300218, 26300492, 26452128, 26484545, 26517537, 26891804, 28062663, 28284891, 28327121, 28408295, 28488170, 28618948, 29088836, 29266978, 29413689, 29426696, 29680948, 29853346, 29978187, 29981911, 30116909, 30135306, 30277889, 30372397, 30405850, 30446457, 30477459, 30519310, 30814637, 30886153, 31034483, 31326218, 31382694		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	22545102, 22889334, 23684012, 23977234, 24243779, 24697775, 25787093, 25803691, 25974357, 27235536, 27640074, 28062663, 28560743, 28793149, 29413689, 29490280, 29981911, 30156010, 30477459, 31382694		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35051358	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24455749	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	22648325, 31233225		★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29088836		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29088836		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33529461	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25839328, 26081045, 29866946	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509, 25231345		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24867389		★☆☆☆☆ Found in Text Mining only
Familial Atypical Mole Melanoma Syndrome	Atypical Mole Melanoma Syndrome	ORPHANET_DG	25431349		★☆☆☆☆ Found in Text Mining only
Familial melanoma	Melanoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Fibrous Meningioma	Fibrous Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	11205133		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30395583		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30395583, 31122820, 33328484	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26611647		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23036577	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26191197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	26337759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	25976522		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIC	Glycogen storage disease	Pubtator	39378214	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29113987		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Head Neoplasms	Head Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Hemangioblastic Meningioma	Hemangioblastic Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Hemangiopericytic Meningioma	Hemangiopericytic Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	36754982	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30716094	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	27819754		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	21941004, 22825583, 23677068, 24243779, 25902915, 26719535, 28662997, 30244062, 30801340		★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	29522175		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	22889334		★☆☆☆☆ Found in Text Mining only
Hibernoma	Hibernoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12123845		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36656861	Associate	★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	26260725		★☆☆☆☆ Found in Text Mining only
Inferior lens subluxation	Inferior lens subluxation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24185509, 24867389, 26709801, 26717940, 27864835, 28122578, 29778232, 30170977, 30305612, 30377796		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	24185509, 25231345		★☆☆☆☆ Found in Text Mining only
Intraorbital Meningioma	Intraorbital Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Intraventricular Meningioma	Intraventricular Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	23036577	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	26719535		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30405850, 30992312		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23867514, 26484545, 30548481, 30992312, 31034483, 32083993, 35637285, 38456787, 40251399	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	29797327	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	22878500, 29797327		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	29769598		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	29528717	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29778232		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	31862487	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21941004, 23977234, 25970771, 26191197, 29528717, 35477182	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	26719535		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26765459, 27553041, 30305612, 34857909	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29113987		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	ORPHANET_DG	21051595, 21941004		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant melanoma of ciliary body	Ciliary body melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant melanoma of iris	Iris melanoma	ORPHANET_DG	21051595, 21941004		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of iris	Iris melanoma	BEFREE	30578689		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of iris	Iris melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21874000, 22321046, 23677068, 23849051, 23963927, 24916674, 25231345, 25380601, 25658628, 25796603, 25889843, 25952750, 26011428, 26246155, 26288396, 26448191, 26463840, 26719535, 26891804, 27121152, 27453164, 27751355, 27834213, 27859460, 27984124, 28551647, 28614305, 28978163, 28994508, 29076876, 29085180, 29345617, 29528717, 29656754, 29763720, 29802871, 29904909, 29961174, 30113886, 30477459, 30520251, 30640754, 30669483, 31151962, 31165505, 31382694		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	24928783, 25231345, 26463840, 26928227, 29112861		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CLINVAR_DG	25687217		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	25222065, 25889843, 27187383, 28034829, 28877056, 29048219, 30001711, 30777124, 30914057, 31713897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16341802, 18949367, 19197335, 25225064, 25658628, 26419610, 26748926, 27834213, 28121081, 28159633, 28170043, 28482042, 28551647, 29206651, 30076753, 30716094, 9528852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29088836		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30395583		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23709298, 26246155, 26484545, 27260871, 30992312, 31034483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	26719535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25970771, 26885612, 27114369, 29088836, 30377796		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	26719535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	12800201		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28756516, 9528852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29778232		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27718540		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23977234		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26774355, 30578689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27352265		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21874000, 22065079, 22268848, 22878500, 23550303, 23585512, 23849051, 23977234, 24187051, 24258989, 24633195, 24697775, 25231345, 25342144, 25380601, 25796603, 25902915, 25953246, 25970771, 25974357, 26022455, 26154183, 26300492, 26409435, 26416890, 26437366, 26448191, 26683624, 26719535, 26774355, 26854086, 26876698, 26900815, 27114369, 27181379, 27223342, 27235536, 27494029, 27553041, 27718540, 27819678, 27834213, 27899189, 28170043, 28275095, 28404968, 28409567, 28459210, 28482042, 28551647, 28560743, 28614305, 28618948, 28665402, 28687356, 28700401, 28793149, 28903138, 28935764, 29053210, 29061454, 29085180, 29088836, 29113987, 29212164, 29266978, 29284740, 29413689, 29426696, 29761599, 29769598, 29785026, 29974497, 29981911, 30116909, 30202049, 30376426, 30395583, 30400891, 30450291, 30578689, 30759271, 30777124, 30801340, 30883995, 30907299, 30992312, 31058963, 31395736, 31635116, 31735283		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29061454		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29159179		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30716094		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	23552620, 25479927, 25902915, 25953246, 26645730, 29974497		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21051595, 22545102, 22834783, 22889334, 23684012, 23849051, 23977234, 24243779, 24697775, 25231345, 25479927, 25803691, 25972334, 25974357, 26154183, 26645730, 26719535, 26892651, 27155448, 27181379, 27235536, 28062663, 28121081, 28404968, 28409567, 28700778, 28793149, 29413689, 29490280, 29530782, 29981911, 30060843, 30156010, 30414346, 30477459, 30801340, 31173190, 31289481, 31382694, 31382929		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22545102, 22613358, 22825583, 22889334, 26106605, 26154183, 26683624, 27181379, 28062663, 28283772, 28404968, 28823399, 28903138, 29371009, 29522175, 29528717, 29554022, 30414346, 30801340, 31173190, 31382929, 32522791, 33322357, 33982545, 34071371, 35052351, 35835335, 36788079, 37088284, 37302484	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37474004	Inhibit	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Melanoma Amelanotic	Melanoma	Pubtator	23977234	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	22545102, 22889334, 22935333, 23550303, 23684012, 23977234, 24243779, 25787093, 25803691, 26154183, 26409435, 26719535, 27181379, 27640074, 28062663, 29166932, 29522175, 30801340, 31706282, 33322357, 34628055	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21941004, 22889334, 26409435, 28170043, 28482042, 29061454, 29981911, 30379704, 31382694		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21941004, 22889334, 26409435, 28062663, 29528717, 33087175, 34628055, 36641486	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Orphanet			★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Meningiomas, Multiple	Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Meningothelial meningioma	Meningothelial Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21642991, 21874000, 22321046, 22878500, 23277170, 23550303, 23963927, 24243779, 24697775, 25231345, 25468148, 25796603, 25830670, 25938359, 25952750, 25970771, 26022455, 26288396, 26337759, 26364129, 26448191, 26683624, 26719535, 26811225, 26900815, 27114369, 27181379, 27223342, 27751355, 27984124, 28034829, 28038708, 28205427, 28213009, 28342657, 28389374, 28603777, 28687356, 28706906, 28793149, 28877056, 29053210, 29069806, 29206890, 29480760, 29507804, 29802871, 30001711, 30060843, 30156010, 30171198, 30315275, 30338612, 30349006, 30354850, 30376426, 30640754, 30642545, 30914057, 31082996, 31165505, 31323388, 31371807, 31619462, 31685964, 31706282		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	21642991, 21874000, 26119930, 26719535		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	21874000, 22065079, 22889334, 23550303, 23963927, 24243779, 25380601, 25803691, 25970771, 26022455, 26191197, 26288396, 26364129, 26409435, 26683624, 26719535, 26774355, 27181379, 27751355, 28062663, 28283772, 28389374, 28687356, 29166932, 29206890, 30001711, 30914057, 31323388, 31706282, 32004714, 32504035, 32678499, 33045147, 34531524, 35459788, 35945149, 36550359, 36656861, 36669126, 36754982, 37167572, 37295554, 37369845, 37916370, 38092371	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26226841, 33399341, 34591877	Inhibit	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21642991, 21874000, 22321046, 22613358, 22825583, 22935333, 23963927, 24128712, 25380601, 25468148, 25514803, 25658628, 25889843, 25970771, 26011428, 26288396, 26493618, 26554828, 27187383, 27422796, 27447750, 27453164, 27751355, 27813512, 27834213, 28034829, 28389374, 28614305, 28756516, 29053210, 29085180, 29528717, 29656754, 30001711, 30113886, 30301262, 30408567, 30669483, 30700254, 30777124, 31371807, 31706282, 31821740, 32036091, 32083805, 32504035, 32678499, 32726133, 32944962, 33112113, 33493384, 34008015, 34227091, 34257556, 34294087, 34597666, 34628055, 34648949, 35032816, 35849291, 35999269, 36669126, 37607989, 38280040, 38383726, 39788204	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33045147	Inhibit	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28823399, 29554022		★☆☆☆☆ Found in Text Mining only
Microcystic meningioma	Microcystic Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	22545102	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22935333, 31706282	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
mucosal melanoma	Mucosal Melanoma	BEFREE	28404968		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22878500		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26118501		★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, 3	Myofibrillar myopathy	BEFREE	17823282		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12800201		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	24952746		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27553041	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30660076	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12800201, 21051595, 22038994, 22321046, 22367297, 22545102, 22683710, 22825583, 22834783, 22878500, 22889334, 23036577, 23277170, 23333114, 23644518, 23677068, 23709298, 23832661, 23849051, 23867514, 23887304, 23915344, 23963927, 23977234, 24076305, 24166983, 24185513, 24187051, 24258989, 24293293, 24347639, 24382589, 24703950, 24705312, 24821879, 24970262, 25080371, 25087671, 25147369, 25184537, 25225064, 25225168, 25342144, 25465300, 25468148, 25479927, 25753955, 25811348, 25830670, 25902915, 25938359, 25952750, 25972334, 25974357, 26022455, 26081045, 26246155, 26260725, 26300218, 26364129, 26416890, 26437366, 26484545, 26611647, 26748926, 26769193, 26774355, 26853494, 26885612, 26891804, 26892651, 26923342, 26933176, 27015033, 27057633, 27116551, 27155448, 27223342, 27235536, 27553041, 27751355, 27813512, 27819678, 27911584, 27984124, 28034829, 28062663, 28122578, 28159633, 28170043, 28275095, 28284891, 28327121, 28342657, 28389374, 28391358, 28404968, 28459210, 28482042, 28488170, 28560743, 28614305, 28618948, 28823399, 28935764, 29061454, 29069806, 29085180, 29088836, 29159179, 29327717, 29371009, 29490280, 29678836, 29686263, 29689622, 29726589, 29753057, 29778232, 29853346, 29981911, 30013160, 30060843, 30073324, 30076753, 30135306, 30156010, 30202049, 30244062, 30266945, 30305612, 30338612, 30349006, 30354850, 30372397, 30395583, 30400891, 30405850, 30477459, 30517737, 30553477, 30639226, 30640754, 30642545, 30660076, 30716094, 30777124, 30801340, 30814637, 30907299, 30914057, 30992312, 31000662, 31058349, 31130514, 31233225, 31375770, 31382450, 31382694, 31416570, 31447003, 31588174, 31623293, 31635116, 31657441, 31734934, 9528852		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	21874000, 22545102, 23341325, 25501392, 25687217, 26096145, 26683624, 26719535, 27181379, 28793149, 28900502		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	21941004, 22878500, 23552620, 24243779, 24697775, 27751355, 29061454, 30156010		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27571062		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30156768		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29686263		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37543638	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27640074	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17586089		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	22825583, 23677068, 25514803, 29904909, 31231129		★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	CTD_human_DG	21874003		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	23552620, 25479927, 25902915, 25953246, 26645730		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nevus of Ota	Nevus of Ota	BEFREE	26701415		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27114369, 27984124, 29266978		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24455749	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ocular melanosis	Ocular Melanosis	BEFREE	31580399		★☆☆☆☆ Found in Text Mining only
Olfactory Groove Meningioma	Olfactory Groove Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	25465300		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25578779, 28256910		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	9528852		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26718727, 33741265, 35443055	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24293293, 29778232		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24293293		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24293293, 28283772	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28662997		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	22889334, 29974497, 31734934		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	22889334	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Parasagittal Meningioma	Parasagittal Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10454131, 10563640, 10665491, 11027850, 11205133, 11716150, 12210873, 12217636, 12775255, 12784265, 14579118, 15048890, 16941465, 17287139, 19141079, 19329225, 21315600, 21693148, 25370916, 25471998, 31309116		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27640074, 32139796	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	11205133		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	27813512, 37042570, 38092371	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31570769	Inhibit	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	26493618, 28034829, 28910456, 30001711, 30777124, 30862609, 30914057, 31570769, 37042570, 37453150, 38092371	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28662997, 31734934		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	11205133		★☆☆☆☆ Found in Text Mining only
Pleomorphic Lipoma	Lipoma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	25889843	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29053210		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	30429020		★☆☆☆☆ Found in Text Mining only
Posterior Fossa Meningioma	Fossa Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27718540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27718540, 32158967	Associate	★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26246155, 26484545, 27260871, 30992312, 31034483		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22683710, 23684012, 23709298, 23832661, 23867514, 24243779, 25080371, 25359211, 26300218, 26300492, 26517537, 26891804, 28062663, 28488170, 28618948, 29088836, 29413689, 29680948, 29978187, 30030490, 30116909, 30477459, 30814637, 31034483, 31326218, 31382694		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG	25687217		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	22683710, 26111976, 28170043	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	27553041	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22321046, 27422796	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29061454		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 22683710, 23797736, 25231345		★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	23550303		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23550303, 37607989	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26719535, 32669118, 35194152	Associate	★☆☆☆☆ Found in Text Mining only
Sphenoid Wing Meningioma	Sphenoid Wing Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Spinal Meningioma	Spinal Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27984124		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26081045		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30548484	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23977234		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26611647, 34145795	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	32029730	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	CTD_human_DG	24974848		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	25482724		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	CTD_human_DG	24974848		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	25482724		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26774355, 30578689		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26774355, 30578689		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26774355	Associate	★☆☆☆☆ Found in Text Mining only
Transitional Meningioma	Transitional Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29760406		★☆☆☆☆ Found in Text Mining only
Tumor of Rete Testis	Tumor of Rete Testis	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	CLINVAR_DG	18757409, 21874000, 22545102, 23684012, 24243779, 25687217, 25974357, 26154183, 26683624, 26719535		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	CLINGEN_DG	21874000, 21874003, 21941004, 22878500, 26119930, 26896281		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	GENOMICS_ENGLAND_DG	21874003		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	ORPHANET_DG	21956388		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	BEFREE	23684012, 25972334, 26154183, 26774355, 27899189, 28482042, 28551647, 30578689, 31206729		★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25225064	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34591877	Inhibit	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30759271		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	ORPHANET_DG	21051595, 21941004		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	21051595, 21874000, 21874003, 21941004, 22065079, 22889334, 22935333, 23550303, 23585512, 23887304, 23977234, 24128712, 24243779, 24423917, 24633195, 25058347, 25147369, 25687217, 25787093, 25803691, 26154183, 26409435, 26683228, 26683624, 26744134, 26774355, 27123562, 27181379, 27718540, 27745836, 28062663, 28391358, 28444874, 28614305, 28618948, 28810145, 28823399, 29166932, 29317634, 29327717, 29530782, 29726589, 30073324, 30395583, 30400891, 30477459, 30883995, 31186267, 31227497, 31285370, 31323388, 31580399, 31588174, 31706282, 31895446, 31960425, 32239153, 32415113, 32953248, 33208912, 33316260, 33355644, 33421325, 33529461, 33798262, 33903674, 34201614, 34227091, 34628055, 34997020, 35046531, 35341390, 35426938, 35920959, 36292588, 36754982, 36788079, 37240204, 37506796, 37607989, 37708024, 37710185, 37958591, 38175637, 38191418, 38644411, 39374010, 39378214	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	21874000, 21941004, 22038994, 22878500, 23277170, 23341325, 23915344, 23977234, 24187051, 24243779, 24258989, 24633195, 24697775, 24970262, 25147369, 25361747, 25479927, 25582751, 25687217, 25787093, 25803691, 25972334, 25974357, 26096145, 26246155, 26683228, 26744134, 26876698, 26923342, 26933176, 27015033, 27123562, 27718540, 27911584, 28062663, 28391358, 28444874, 28482042, 28618948, 28700778, 28793149, 28823399, 29061454, 29206651, 29266978, 29317634, 29490280, 29530782, 29689622, 30395583, 30400891, 30477459, 30517737, 30578689, 30716094, 30883995, 31058963, 31323388, 31337000, 31382450, 31382694, 31418658, 31555735, 31580399, 31588174, 31623293, 31626034, 31635116, 31671564, 31741854		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	CTD_human_DG	21874000, 25231345, 26719535		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	CLINVAR_DG	25687217		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30716094, 34591877	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	25359211		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	29528717	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatous Meningioma	Xanthomatous Meningioma	CTD_human_DG	25231345		★☆☆☆☆ Found in Text Mining only