CD5L (CD5 molecule like)

Gene

• Entrez ID: 922
• Gene name: CD5 molecule like
• Gene symbol: CD5L
• Synonyms (NCBI Gene): AIM, API6, CT-2, PRO229, SP-ALPHA, Spalpha, hAIM
• Chromosome: 1
• Chromosome location: 1q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017271	hsa-miR-335-5p	Microarray	18185580
MIRT876080	hsa-miR-1298	CLIP-seq
MIRT876081	hsa-miR-1908	CLIP-seq
MIRT876082	hsa-miR-382	CLIP-seq
MIRT876083	hsa-miR-3937	CLIP-seq
MIRT876084	hsa-miR-409-3p	CLIP-seq
MIRT876085	hsa-miR-4289	CLIP-seq
MIRT876086	hsa-miR-4326	CLIP-seq
MIRT876087	hsa-miR-4436b-3p	CLIP-seq
MIRT876088	hsa-miR-4640-5p	CLIP-seq
MIRT876089	hsa-miR-4726-5p	CLIP-seq
MIRT876090	hsa-miR-663	CLIP-seq
MIRT876091	hsa-miR-744	CLIP-seq
MIRT2196663	hsa-miR-1185	CLIP-seq
MIRT2196664	hsa-miR-1224-5p	CLIP-seq
MIRT2196665	hsa-miR-1304	CLIP-seq
MIRT2196666	hsa-miR-2355-5p	CLIP-seq
MIRT2196667	hsa-miR-3605-5p	CLIP-seq
MIRT2196668	hsa-miR-3609	CLIP-seq
MIRT2196669	hsa-miR-3679-5p	CLIP-seq
MIRT2196670	hsa-miR-3915	CLIP-seq
MIRT2196671	hsa-miR-4464	CLIP-seq
MIRT2196672	hsa-miR-451b	CLIP-seq
MIRT2196673	hsa-miR-4689	CLIP-seq
MIRT2196674	hsa-miR-4748	CLIP-seq
MIRT2196675	hsa-miR-520g	CLIP-seq
MIRT2196676	hsa-miR-520h	CLIP-seq
MIRT2196677	hsa-miR-542-3p	CLIP-seq
MIRT2196678	hsa-miR-548ah	CLIP-seq
MIRT2385749	hsa-miR-1207-5p	CLIP-seq
MIRT2385750	hsa-miR-4736	CLIP-seq
MIRT2385751	hsa-miR-4763-3p	CLIP-seq
MIRT2385752	hsa-miR-568	CLIP-seq
MIRT2385753	hsa-miR-657	CLIP-seq
MIRT2499851	hsa-miR-199a-5p	CLIP-seq
MIRT2499852	hsa-miR-199b-5p	CLIP-seq
MIRT2499853	hsa-miR-3714	CLIP-seq
MIRT2499854	hsa-miR-4753-5p	CLIP-seq
MIRT2499855	hsa-miR-548an	CLIP-seq
MIRT2499856	hsa-miR-940	CLIP-seq
MIRT2499851	hsa-miR-199a-5p	CLIP-seq
MIRT2499852	hsa-miR-199b-5p	CLIP-seq
MIRT2499853	hsa-miR-3714	CLIP-seq
MIRT2499854	hsa-miR-4753-5p	CLIP-seq
MIRT2499855	hsa-miR-548an	CLIP-seq
MIRT2499856	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	TAS	9045627
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006968	Process	Cellular defense response	TAS	9045627
GO:0009986	Component	Cell surface	IDA	25284781
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0030449	Process	Regulation of complement activation	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1903661	Process	Positive regulation of complement-dependent cytotoxicity	IEA

Other IDs

• MIM: 602592
• HGNC: 1690
• e!Ensembl: ENSG00000073754

Protein

• UniProt ID: O43866
• Protein name: CD5 antigen-like (Apoptosis inhibitor expressed by macrophages) (hAIM) (CT-2) (IgM-associated peptide) (SP-alpha)
• Protein function: Secreted protein that acts as a key regulator of lipid synthesis: mainly expressed by macrophages in lymphoid and inflamed tissues and regulates mechanisms in inflammatory responses, such as infection or atherosclerosis. Able to inhibit lipid dr
• PDB: 8R83, 8R84, 8WYR, 8WYS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00530	SRCR	27 → 125	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	141 → 239	Scavenger receptor cysteine-rich domain	Domain
  PF00530	SRCR	247 → 346	Scavenger receptor cysteine-rich domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spleen, lymph node, thymus, bone marrow, and fetal liver, but not in non-lymphoid tissues. {ECO:0000269|PubMed:9045627}.
• Sequence:

  MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
  LCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
  GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLG
  CGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
  PFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFRDRKC
  YGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG

• Sequence length: 347

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	27989757		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30371224		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24281248, 29301785, 29500407		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	9587073		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24281248, 29301785, 29500407		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24526693, 29593730	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30368628, 30840040		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31763860		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24281248, 31639516		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28055119		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30850364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19656391	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28550167, 32148377, 34980144	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36939243	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28807460, 31131629		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23497247		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33172404	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27232630	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	19116453	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31226384		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28851702, 31669066		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35068329	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31669066		★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	27989757		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	31275144		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	19116453	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30177770		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39490745	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29086016		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31076347		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34629330	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30092411, 31791376		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	34629330	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26846784		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29375122		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26726878, 28743989, 29375122, 30177770, 30310974, 30582197		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29086016, 29465313, 30177770, 30487357, 30755830		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26048980		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	2265488	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30173083		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	9395354		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	27989757	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31230885		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28055119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29465313		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26048980, 29593730		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30499223		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28279371, 28628560, 28807460, 29301785, 30371334		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36864689	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28117336		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29121663		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	9395354		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18416454, 24583822, 29465313, 30177770		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29086016, 30487357		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24281248, 28743989, 30177770		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35185790	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35745003	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	27979753		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29695737	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23497247	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	26726878		★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	BEFREE	20522431		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30326743, 31154043		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30177770		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34629330	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24336635		★☆☆☆☆ Found in Text Mining only