DAPL1 (death associated protein like 1)

Gene

• Entrez ID: 92196
• Gene name: Death associated protein like 1
• Gene symbol: DAPL1
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2q24.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT923191	hsa-miR-1207-3p	CLIP-seq
MIRT923192	hsa-miR-1827	CLIP-seq
MIRT923193	hsa-miR-320a	CLIP-seq
MIRT923194	hsa-miR-320b	CLIP-seq
MIRT923195	hsa-miR-320c	CLIP-seq
MIRT923196	hsa-miR-320d	CLIP-seq
MIRT923197	hsa-miR-4429	CLIP-seq
MIRT923198	hsa-miR-4435	CLIP-seq
MIRT923199	hsa-miR-4720-3p	CLIP-seq
MIRT923200	hsa-miR-4775	CLIP-seq
MIRT923201	hsa-miR-4804-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030371	Function	Translation repressor activity	ISS
GO:0031369	Function	Translation initiation factor binding	ISS
GO:0043022	Function	Ribosome binding	IBA
GO:0043022	Function	Ribosome binding	ISS
GO:0097190	Process	Apoptotic signaling pathway	IBA
GO:0141014	Process	Ribosome hibernation	IBA
GO:0141014	Process	Ribosome hibernation	ISS
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IEA
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	ISS

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A0PJW8
• Protein name: Death-associated protein-like 1 (Early epithelial differentiation-associated protein)
• Protein function: May play a role in the early stages of epithelial differentiation or in apoptosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15228	DAP	13 → 106	Death-associated protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in hair follicle (at protein level). {ECO:0000269|PubMed:15920738}.
• Sequence:

  MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTL
  DALNDALEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC

• Sequence length: 107

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	25680934, 28334846		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	34946854	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25680934	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33463119	Associate	★☆☆☆☆ Found in Text Mining only