Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9219
Gene name	Metastasis associated 1 family member 2
Gene symbol	MTA2
Synonyms (NCBI Gene)	MTA1L1PID
Chromosome	11
Chromosome location	11q12.3
Summary	This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may r

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004731	hsa-miR-146a-5p	qRT-PCRWestern blot	20124483
MIRT004117	hsa-miR-661	Western blot	19584269
MIRT004116	hsa-miR-559	Western blot	19584269
MIRT017668	hsa-miR-335-5p	Microarray	18185580
MIRT025233	hsa-miR-34a-5p	Proteomics	21566225
MIRT025233	hsa-miR-34a-5p	Proteomics	21566225
MIRT025233	hsa-miR-34a-5p	Reporter assay;Western blot;Other	20018894
MIRT046730	hsa-miR-222-3p	CLASH	23622248
MIRT044965	hsa-miR-186-5p	CLASH	23622248
MIRT044044	hsa-miR-365a-3p	CLASH	23622248
MIRT042480	hsa-miR-423-3p	CLASH	23622248
MIRT041029	hsa-miR-505-3p	CLASH	23622248
MIRT040512	hsa-miR-548a-3p	CLASH	23622248
MIRT040292	hsa-miR-615-3p	CLASH	23622248
MIRT040292	hsa-miR-615-3p	CLASH	23622248
MIRT038634	hsa-miR-125b-2-3p	CLASH	23622248
MIRT737195	hsa-miR-589-3p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	31452724
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT1162182	hsa-miR-146a	CLIP-seq
MIRT1162183	hsa-miR-146b-5p	CLIP-seq
MIRT1162184	hsa-miR-3145-5p	CLIP-seq
MIRT1162185	hsa-miR-3148	CLIP-seq
MIRT1162186	hsa-miR-3156-5p	CLIP-seq
MIRT1162187	hsa-miR-3687	CLIP-seq
MIRT1162188	hsa-miR-371-5p	CLIP-seq
MIRT1162189	hsa-miR-4251	CLIP-seq
MIRT1162190	hsa-miR-4278	CLIP-seq
MIRT1162191	hsa-miR-4303	CLIP-seq
MIRT1162192	hsa-miR-4311	CLIP-seq
MIRT1162193	hsa-miR-4329	CLIP-seq
MIRT1162194	hsa-miR-4442	CLIP-seq
MIRT1162195	hsa-miR-4496	CLIP-seq
MIRT1162196	hsa-miR-4688	CLIP-seq
MIRT1162197	hsa-miR-4762-3p	CLIP-seq
MIRT1162198	hsa-miR-589	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2046490	hsa-miR-3591-3p	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2046493	hsa-miR-4685-5p	CLIP-seq
MIRT2046494	hsa-miR-4719	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046499	hsa-miR-513b	CLIP-seq
MIRT2046500	hsa-miR-570	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275598	hsa-miR-1204	CLIP-seq
MIRT2275599	hsa-miR-1252	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275601	hsa-miR-1276	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275604	hsa-miR-3170	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2275610	hsa-miR-4533	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2574594	hsa-miR-3202	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2574595	hsa-miR-4464	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2574596	hsa-miR-4690-3p	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2574597	hsa-miR-4748	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2574594	hsa-miR-3202	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2574595	hsa-miR-4464	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2574597	hsa-miR-4748	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IEA
GO:0000118	Component	Histone deacetylase complex	TAS	10444591
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000785	Component	Chromatin	HDA	16217013
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005515	Function	Protein binding	IPI	17646674, 17956988, 18451879, 19703393, 20127688, 21258344, 23752268, 24981860, 25150861, 26028330, 26030138, 26496610, 26949739, 27705803, 28179136, 28514442, 31980649, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15920471
GO:0006325	Process	Chromatin organization	TAS	10444591
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15920471, 22926524
GO:0071514	Process	Genomic imprinting	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

MIM	HGNC	e!Ensembl
603947	7411	ENSG00000149480

O94776

Protein name

Metastasis-associated protein MTA2 (Metastasis-associated 1-like 1) (MTA1-L1 protein) (p53 target protein in deacetylase complex)

Protein function

May function as a transcriptional coregulator (PubMed:16428440, PubMed:28977666). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). {ECO:0000269|PubM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01426	BAH	4 → 144	BAH domain	Domain
PF01448	ELM2	147 → 199	ELM2 domain	Family
PF00320	GATA	367 → 404	GATA zinc finger	Domain
PF17226	MTA_R1	447 → 524	MTA R1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
PINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
NEPIVLED

Sequence length

668

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HDACs deacetylate histones Regulation of TP53 Activity through Acetylation RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (76)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Hemolytic	Hemolytic anemia	Pubtator	19687298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30814496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	29294638, 31456714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28902066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	31396239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30699870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22238607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	29069625, 30699870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25048531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21447808, 25081667, 27597141, 31452724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16645043, 30642362, 36913304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	25367169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29708271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26722504, 36575438, 37371463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22238607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22585429, 31388311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23400716	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29117913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26261611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	31396239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	28370285, 29867916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement deficiency disease	Complement Component Deficiency	BEFREE	15821893, 31396239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31771219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	28902066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	28333195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	25048531, 27682888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	26472314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28459682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28602010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30321535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26503572		★★★★★ ★☆☆☆☆ Found in Text Mining only
IRAK4 Deficiency	IRAK4 Deficiency	BEFREE	26472314		★★★★★ ★☆☆☆☆ Found in Text Mining only
ITK Deficiency	Lymphoproliferative syndrome	BEFREE	30572125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31359510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31128910, 31777601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23400716	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21447808, 25081667, 27597141, 31452724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31771219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22585429, 31388311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31359510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31410216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24010737, 25929737, 27065326, 28502558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22238607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25929737, 29589566, 29708271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16645043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16645043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24850177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31821216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29589566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36454786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21447808, 22585429, 23400716, 25048531, 25929737, 29393472, 31359510, 31452724, 31771219, 31777601		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	27322578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22585429, 29393472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29708271, 31410216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23400716, 30814496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20124483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23400716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	27336839, 27670287, 27893225, 28072042, 29565615, 29757006, 29781652, 30079926, 31008463, 31206343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31291582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	19801557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31771219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31771219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26254420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23250629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24010737, 25929737, 27065326, 28502558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25929737, 35484118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32940102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31452724		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	26407811		★★★★★ ★☆☆☆☆ Found in Text Mining only

MTA2 (metastasis associated 1 family member 2)