MTG1 (mitochondrial ribosome associated GTPase 1)

Gene

• Entrez ID: 92170
• Gene name: Mitochondrial ribosome associated GTPase 1
• Gene symbol: MTG1
• Synonyms (NCBI Gene): GTP, GTPBP7
• Chromosome: 10
• Chromosome location: 10q26.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT041976	hsa-miR-484	CLASH	23622248
MIRT040253	hsa-miR-615-3p	CLASH	23622248
MIRT647826	hsa-miR-4323	HITS-CLIP	19536157
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT647823	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710882	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710881	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT647828	hsa-miR-634	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	23824327
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT647825	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647824	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647823	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647820	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647819	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	19536157
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT647823	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710882	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710881	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT647828	hsa-miR-634	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	23824327
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT647825	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647824	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647823	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647820	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647819	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT1163103	hsa-miR-1266	CLIP-seq
MIRT1163104	hsa-miR-4270	CLIP-seq
MIRT1163105	hsa-miR-4441	CLIP-seq
MIRT1163106	hsa-miR-4518	CLIP-seq
MIRT1163107	hsa-miR-4646-5p	CLIP-seq
MIRT1163108	hsa-miR-558	CLIP-seq
MIRT1163109	hsa-miR-767-3p	CLIP-seq
MIRT2275941	hsa-miR-1972	CLIP-seq
MIRT2275942	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	23396448
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	23396448
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	30085276
GO:0005759	Component	Mitochondrial matrix	IDA	23396448
GO:0005761	Component	Mitochondrial ribosome	IDA	23396448
GO:0006417	Process	Regulation of translation	IEA
GO:0016020	Component	Membrane	IEA
GO:0044065	Process	Regulation of respiratory system process	IMP	23396448
GO:0070129	Process	Regulation of mitochondrial translation	IMP	23396448
GO:1902775	Process	Mitochondrial large ribosomal subunit assembly	IMP	30085276

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BT17
• Protein name: Mitochondrial ribosome-associated GTPase 1 (GTP-binding protein 7) (Mitochondrial GTPase 1)
• Protein function: Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity.
• PDB: 7O9K, 7O9M, 7PD3, 8PK0, 8QSJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01926	MMR_HSR1	145 → 292	50S ribosome-binding GTPase	Family

• Sequence:

  MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARI
  PLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVK
  QIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEP
  GITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYL
  LYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPA
  AARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP

• Sequence length: 334

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29348842		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	31571132		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29348842		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31105878		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30321187		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29330604		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	30367518		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	29348842		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29884911		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	31571132		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30707992		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28487984		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30321187		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30321187		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31105878		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30393249		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30707992		★☆☆☆☆ Found in Text Mining only
HOYERAAL-HREIDARSSON SYNDROME	Hoyeraal-Hreidarsson Syndrome	BEFREE	30367518		★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia, familial, 6	Hyperinsulinemic hypoglycemia	BEFREE	30367518		★☆☆☆☆ Found in Text Mining only
HYPOTRICHOSIS 1	Hypotrichosis	BEFREE	30367518		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29348842, 31428857		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30510251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29348842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29348842		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27941875, 29382720, 30349644, 30433760, 30991803, 31545475		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28107600, 30991803, 31572059		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27721150		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28750799		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30321187		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	31130282		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30810638		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	29628140		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28487984		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30664871		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30393249		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31338333, 31572059		★☆☆☆☆ Found in Text Mining only
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	BEFREE	30367518		★☆☆☆☆ Found in Text Mining only