Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9212
Gene name	Aurora kinase B
Gene symbol	AURKB
Synonyms (NCBI Gene)	AIK2AIM-1AIM1ARK-2ARK2AurBIPL1PPP1R48STK-1STK12STK5aurkb-sv1aurkb-sv2
Chromosome	17
Chromosome location	17p13.1
Summary	This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregatio

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1597343914	G>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004742	hsa-miR-16-5p	MicroarrayqRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	MicroarrayqRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	MicroarrayqRT-PCR	19738602
MIRT000120	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT000120	hsa-miR-24-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	19748357
MIRT001649	hsa-let-7b-5p	pSILAC	18668040
MIRT020616	hsa-miR-155-5p	Proteomics	18668040
MIRT022319	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT000120	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT004742	hsa-miR-16-5p	Proteomics	18668040
MIRT001649	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT049133	hsa-miR-92a-3p	CLASH	23622248
MIRT048044	hsa-miR-148a-3p	CLASH	23622248
MIRT046053	hsa-miR-125b-5p	CLASH	23622248
MIRT053129	hsa-let-7a-5p	Luciferase reporter assayWestern blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assayWestern blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assayWestern blot	23769985
MIRT437396	hsa-let-7e-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23774216
MIRT437396	hsa-let-7e-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23774216
MIRT001649	hsa-let-7b-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRFlow cytometry	32856506
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT812190	hsa-miR-1248	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812192	hsa-miR-3124-3p	CLIP-seq
MIRT812193	hsa-miR-3162-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT1940222	hsa-miR-3679-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
E2F1	Unknown	15033491
E2F4	Unknown	15033491

Show/Hide all (92)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20959462
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	NAS	17956729
GO:0000281	Process	Mitotic cytokinesis	NAS	17956729
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	26829474
GO:0000776	Component	Kinetochore	IDA	22024163
GO:0000776	Component	Kinetochore	IEA
GO:0000779	Component	Condensed chromosome, centromeric region	IDA	18195732, 19465021
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0002903	Process	Negative regulation of B cell apoptotic process	IDA	20959462
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	21397845
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	26829474
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18455984, 22371557, 22724069, 25666058, 28751710, 30100357, 30409912, 31804178, 33542149
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	TAS	19774610
GO:0005515	Function	Protein binding	IPI	12689593, 15064709, 16179162, 16239925, 16291752, 17099693, 17543862, 17681274, 17726514, 17956729, 18243099, 18477699, 19357306, 20562864, 20739936, 20959462, 21051298, 21346195, 21988832, 22939624, 23036704, 24571573, 24857377, 25036637, 26829474, 27332895, 28514442, 29340707, 295
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20959462
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	TAS	19774610
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0007051	Process	Spindle organization	IMP	21820309
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0010369	Component	Chromocenter	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	9859993
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019900	Function	Kinase binding	IPI	23036704
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	17726514
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	TAS	19774610
GO:0031117	Process	Positive regulation of microtubule depolymerization	IDA	31804178
GO:0032133	Component	Chromosome passenger complex	IBA
GO:0032133	Component	Chromosome passenger complex	IEA
GO:0032133	Component	Chromosome passenger complex	IPI	15260989, 17956729, 18591255
GO:0032133	Component	Chromosome passenger complex	TAS	19774610
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765
GO:0032465	Process	Regulation of cytokinesis	IBA
GO:0032466	Process	Negative regulation of cytokinesis	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	16103226
GO:0032467	Process	Positive regulation of cytokinesis	TAS	19774610
GO:0032886	Process	Regulation of microtubule-based process	IEA
GO:0034501	Process	Protein localization to kinetochore	IMP	19468067
GO:0034644	Process	Cellular response to UV	IDA	20959462
GO:0036089	Process	Cleavage furrow formation	IDA	16103226
GO:0036089	Process	Cleavage furrow formation	IEA
GO:0043687	Process	Post-translational protein modification	IEA
GO:0043687	Process	Post-translational protein modification	ISS
GO:0044839	Process	Cell cycle G2/M phase transition	IDA	33542149
GO:0044839	Process	Cell cycle G2/M phase transition	IEA
GO:0044878	Process	Mitotic cytokinesis checkpoint signaling	ISS
GO:0045824	Process	Negative regulation of innate immune response	IDA	33542149
GO:0051233	Component	Spindle midzone	IBA
GO:0051256	Process	Mitotic spindle midzone assembly	IMP	16103226
GO:0051256	Process	Mitotic spindle midzone assembly	NAS	17956729
GO:0051256	Process	Mitotic spindle midzone assembly	TAS	19774610
GO:0051301	Process	Cell division	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	30409912
GO:0051983	Process	Regulation of chromosome segregation	TAS	19774610
GO:0061952	Process	Midbody abscission	ISS
GO:0062033	Process	Positive regulation of mitotic sister chromatid segregation	IDA	26829474, 30409912
GO:0090068	Process	Positive regulation of cell cycle process	IEA
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	NAS	17956729
GO:0090307	Process	Mitotic spindle assembly	NAS	17956729
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140273	Process	Repair of mitotic kinetochore microtubule attachment defect	IDA	22371557
GO:0140896	Process	CGAS/STING signaling pathway	IDA	32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	33542149
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1901970	Process	Positive regulation of mitotic sister chromatid separation	NAS	17956729
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	NAS	17956729
GO:1903490	Process	Positive regulation of mitotic cytokinesis	NAS	17956729
GO:1905116	Process	Positive regulation of lateral attachment of mitotic spindle microtubules to kinetochore	IDA	28751710
GO:1990023	Component	Mitotic spindle midzone	IEA
GO:1990758	Process	Mitotic sister chromatid biorientation	IDA	22371557

MIM	HGNC	e!Ensembl
604970	11390	ENSG00000178999

Q96GD4

Protein name

Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine

Protein function

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis (PubMed:11516652, PubMed:12925766, PubMed:14610074, PubMed:14722118, PubMed:29449677). The CPC complex has es

PDB

4AF3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	77 → 327	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase. {ECO:0000269|

Sequence

MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA

Sequence length

344

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex Cell cycle		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion SUMOylation of DNA replication proteins RHO GTPases Activate Formins Regulation of TP53 Activity through Phosphorylation Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
NK-cell enteropathy	Likely pathogenic	rs1597343914	RCV000791307	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURKB-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (174)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	22940834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24382688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20303016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	27091351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18699967, 28390310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31198635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29549256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24382688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25739120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	14722913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15562011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	22419576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	24782314, 29707994, 31967936, 33293370, 35044816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31025257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	29653228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26057128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22971244, 27106762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27106762, 28595628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21470402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25277659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30428726, 31597600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16762494, 22382783, 22688343, 24324792, 27101368, 31244554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21707964, 24324792, 25755770, 25885472, 29196757, 31083605, 31142743, 34736137, 35456460, 36281185, 40710353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36113844	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	21470402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	37436268, 38099309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26061684, 28427193, 31894128, 31982864, 34736137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16222316, 19074838, 23114921, 23929435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19134008, 20799978, 28427193, 29962817, 32337237, 32379058, 32627011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	25531179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30428726, 31597600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17483322, 18708766, 23117881, 29707994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37820923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37096681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26061684, 31489573, 32626756, 32986937, 34870494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28095398	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32340320, 37442189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23114921, 25411027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	23695888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract Nuclear Progressive	Congenital cataract	Pubtator	37021526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28522591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22940834, 24382688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25739120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	22809428	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	30513041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	31289316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19134008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21057000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26423403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11453556, 22382783, 25680570, 26259750, 28390310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26423403, 40018943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20732714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31489573, 31576249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21087322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	2569023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16311121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18563336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23769985, 32727972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16572587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16572587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21470402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25483190, 30979745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	BEFREE	20467329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16171786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17264249, 20467329, 22160182, 25553095, 34465813, 37644431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30334671, 31563286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30334671, 31563286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15072448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19079141, 22130050, 22382783, 31353228, 31563286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20529377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20138567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32083704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	37436268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	33277547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15993841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	24683001		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	25133636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30917319		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22359551, 27612557, 28662510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28662510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20732714, 22419576, 22940834, 23557198, 31207577, 34171263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	24683001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20013323, 20159992, 20732714, 22940834, 28292940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18311747, 19134008, 19941009, 20799978, 22722494, 23893130, 24153013, 30263005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19134008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19134008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18708766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18708766, 32655004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25755770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26638998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19079141, 22382783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20138567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	24683001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16762494, 19470724, 22382783, 24324792, 27101368, 31244554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22858681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17483322, 18708766, 23117881, 29707994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22895067, 23114921, 25411027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12120238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16267859, 22127895, 22751009, 24769028, 25277659, 28670704, 28747635, 30242092, 30544954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15993841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23572383, 27270838, 28843004, 30540594, 31521144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30428726, 31142743, 31597600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16267859, 16311121, 16982739, 17041088, 17681274, 22136356, 22159225, 22222631, 22843098, 23788275, 24189697, 24680981, 25752998, 25807528, 26133385 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21057000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21707964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24683001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25739120		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11323215, 11700328, 19194464, 22402438, 23416158, 25623468, 8700511, 9096375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25623468, 34812139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22402438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28747635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30183556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32083704, 37641028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	40455761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18076711, 19548309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19171872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22419576, 23092930, 29220700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22419576, 23092930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29387948		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	31706019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28453729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25986250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35509856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15866028, 15923616, 18084327, 19134008, 19332642, 20467329, 20799978, 21646403, 21762492, 22402438, 22510872, 22858681, 23313006, 23416158, 23504335 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20651058, 25268132, 26497213, 31416840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40229714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16222316, 18708766, 23313006, 26712741, 28095398, 29547267, 29707994, 31000705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30183556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27866912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24129234, 25120775, 25874486, 31122179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25197332, 25874486, 25997616, 27888627, 30568492, 30790360, 31122179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23114921, 25411027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22895067, 26992217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	23114921, 24756216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12120238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29970506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25807528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31519154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30733284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16267859, 22127895, 22751009, 24769028, 25277659, 28100163, 28670704, 30544954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23075505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32655004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26061684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33704359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	19074838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	19074838, 25483190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	22419576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20368716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	20629650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	40229714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22222631, 23035247, 30373918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23035247, 26772203, 37289191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17235564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28095398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20112500, 21470402, 29129699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21496390, 24980817, 36165728, 36169922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32300176	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20138567, 25192874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27270838, 28843004, 30540594, 31521144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15993841		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	31521144, 31982864	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	36627281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	22771711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15562011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 37675898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30773992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31312514, 36627281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	28410270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36181054, 36529823, 37740761, 39456780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	27779297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20622363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AURKB (aurora kinase B)