LGI1 (leucine rich glioma inactivated 1)

Gene

• Entrez ID: 9211
• Gene name: Leucine rich glioma inactivated 1
• Gene symbol: LGI1
• Synonyms (NCBI Gene): ADLTE, ADPAEF, ADPEAF, EPITEMPIN, EPT, ETL1, IB1099
• Chromosome: 10
• Chromosome location: 10q23.33
• Summary: This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937874	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant, intron variant
rs28939075	T>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant, intron variant
rs104894167	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs146425212	A>C,G	Conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, missense variant, non coding transcript variant, synonymous variant
rs148862146	C>T	Conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, non coding transcript variant, synonymous variant
rs797044997	C>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs797044998	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant, genic downstream transcript variant, non coding transcript variant
rs797044999	C>T	Pathogenic	Coding sequence variant, intron variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs869025201	T>C	Pathogenic	Coding sequence variant, intron variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs886039496	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant, genic downstream transcript variant, non coding transcript variant
rs934556455	C>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, intron variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs1060502053	G>A	Pathogenic	Stop gained, non coding transcript variant, intron variant, genic downstream transcript variant, coding sequence variant
rs1060502054	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs1064794249	G>A	Likely-pathogenic	Non coding transcript variant, intron variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1064797149	C>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1364913665	AT>-	Pathogenic	Frameshift variant, intron variant, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs1554907767	->AATAGTCAGAA	Pathogenic	Intron variant, non coding transcript variant, inframe indel, stop gained, coding sequence variant, genic downstream transcript variant
rs1554907787	T>G	Pathogenic	Intron variant, non coding transcript variant, stop gained, coding sequence variant, genic downstream transcript variant
rs1564851314	G>T	Likely-pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1108339	hsa-miR-1269	CLIP-seq
MIRT1108340	hsa-miR-1269b	CLIP-seq
MIRT1108341	hsa-miR-1288	CLIP-seq
MIRT1108342	hsa-miR-3654	CLIP-seq
MIRT1108343	hsa-miR-378	CLIP-seq
MIRT1108344	hsa-miR-378b	CLIP-seq
MIRT1108345	hsa-miR-378c	CLIP-seq
MIRT1108346	hsa-miR-378d	CLIP-seq
MIRT1108347	hsa-miR-378e	CLIP-seq
MIRT1108348	hsa-miR-378f	CLIP-seq
MIRT1108349	hsa-miR-378h	CLIP-seq
MIRT1108350	hsa-miR-378i	CLIP-seq
MIRT1108351	hsa-miR-422a	CLIP-seq
MIRT1108352	hsa-miR-4477b	CLIP-seq
MIRT1108353	hsa-miR-4515	CLIP-seq
MIRT1108354	hsa-miR-4520a-3p	CLIP-seq
MIRT1108355	hsa-miR-4638-3p	CLIP-seq
MIRT1108356	hsa-miR-4740-5p	CLIP-seq
MIRT1108357	hsa-miR-499-3p	CLIP-seq
MIRT1108358	hsa-miR-499a-3p	CLIP-seq
MIRT2260819	hsa-miR-889	CLIP-seq
MIRT2430724	hsa-miR-30a	CLIP-seq
MIRT2430725	hsa-miR-30b	CLIP-seq
MIRT2430726	hsa-miR-30c	CLIP-seq
MIRT2430727	hsa-miR-30d	CLIP-seq
MIRT2430728	hsa-miR-30e	CLIP-seq
MIRT2430729	hsa-miR-4495	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IPI	20463223
GO:0005102	Function	Signaling receptor binding	IPI	20463223
GO:0005515	Function	Protein binding	IPI	20463223, 27066583
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17067999
GO:0005615	Component	Extracellular space	IDA	17067999
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007399	Process	Nervous system development	TAS	9879993
GO:0007411	Process	Axon guidance	IMP	20463223
GO:0030307	Process	Positive regulation of cell growth	IMP	20463223
GO:0030425	Component	Dendrite	IEA
GO:0031175	Process	Neuron projection development	IMP	20463223
GO:0043083	Component	Synaptic cleft	IEA
GO:0043194	Component	Axon initial segment	IEA
GO:0045202	Component	Synapse	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA

Other IDs

• MIM: 604619
• HGNC: 6572
• e!Ensembl: ENSG00000108231

Protein

• UniProt ID: O95970
• Protein name: Leucine-rich glioma-inactivated protein 1 (Epitempin-1)
• Protein function: Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission
• PDB: 5Y2Z, 5Y30, 5Y31, 8HPY, 8HQ1, 8HQ2, 8Y6B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	69 → 127	Leucine rich repeat	Repeat
  PF13855	LRR_8	115 → 175	Leucine rich repeat	Repeat
  PF03736	EPTP	225 → 266	EPTP domain	Repeat
  PF03736	EPTP	271 → 312	EPTP domain	Repeat
  PF03736	EPTP	317 → 363	EPTP domain	Repeat
  PF03736	EPTP	366 → 414	EPTP domain	Repeat
  PF03736	EPTP	419 → 461	EPTP domain	Repeat
  PF03736	EPTP	464 → 505	EPTP domain	Repeat
  PF03736	EPTP	510 → 550	EPTP domain	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in neural tissues, especially in brain. Expression is reduced in low-grade brain tumors and significantly reduced or absent in malignant gliomas. {ECO:0000269|PubMed:16518856}.; TISSUE SPECIFICITY: [Isoform 1]:
• Sequence:

  MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS
  IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
  FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
  LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
  TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
  QLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIY
  KWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
  TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQ
  PLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
  FKGNTQIYKHVIVDLSA

• Sequence length: 557

Pathways

Reactome:

LGI-ADAM interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant epilepsy with auditory features	Likely pathogenic; Pathogenic	rs2134020777, rs2133975489, rs2134017952, rs2134021516, rs2134026513, rs2134026684, rs1027289865, rs2134017940, rs2134027169, rs104894166, rs119488099, rs797044999, rs797044998, rs2492919720, rs2059988348, rs2492903992, rs148862146, rs2492860700, rs1060502054, rs1060502053, rs1064794249, rs1554907835, rs1554907787, rs1554907767, rs1564845068, rs1564851314, rs1589776148, rs1364913665	RCV002242881 RCV002242924 RCV002242806 RCV002242849 RCV002242923 RCV001929947 RCV001939695 RCV001956161 RCV001940095 RCV003595853 RCV002227996 RCV003595879 RCV003595878 RCV002824342 RCV003596947 RCV003596856 RCV003597027 RCV003762640 RCV002230371 RCV002230817 RCV003595993 RCV002231763 RCV002231762 RCV002233483 RCV002233713 RCV002233238 RCV002234945 RCV002234247	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Epilepsy, familial temporal lobe, 1	Likely pathogenic; Pathogenic	rs2059593242, rs1027289865, rs2134026964, rs2134026453, rs869025201, rs28937874, rs2134020917, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs797044999, rs797044998, rs2492801872, rs2492905831, rs2492905676, rs1364913665, rs2059583625, rs2059586444	RCV001330013 RCV003228039 RCV002077370 RCV002244147 RCV000207482 RCV000005763 RCV000005764 RCV000005765 RCV000005766 RCV000005768 RCV000005769 RCV000005770 RCV000005771 RCV000005772 RCV000192478 RCV000193378 RCV003388897 RCV003448527 RCV003494072 RCV002487662 RCV001262511 RCV001291524	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Genitopatellar syndrome	Pathogenic	rs2134026964	RCV002077370	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LGI1-related disorder	Likely pathogenic; Pathogenic	rs119488099, rs2492904557	RCV003407283 RCV003403044	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Seizure	Likely pathogenic; Pathogenic	rs797044999, rs886039496, rs1370527260, rs1364913665	RCV004546453 RCV004577328 RCV003384292 RCV006261988	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autosomal dominant epilepsy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT LATERAL TEMPORAL LOBE EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bilateral tonic-clonic seizure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY WITH AUDITORY FEATURES	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, FAMILIAL TEMPORAL LOBE 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Likely benign; Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Neuromyotonia	Acquired Neuromyotonia	BEFREE	30724344		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	27717669, 31432233		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	19064878	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12942323		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23651915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23713523, 29195105, 30076629, 30112956, 31142216, 31352183		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	36621173, 37217310	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal dominant epilepsy with auditory features	Epilepsy With Auditory Features	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal Dominant Lateral Temporal Lobe Epilepsy	Temporal lobe epilepsy	BEFREE	11810107, 12095917, 12601709, 12771268, 14643004, 15021241, 15079010, 15079011, 15090473, 15660777, 15827762, 15946341, 16190946, 16518856, 16707245, 18711109, 19064878, 19191227, 19552651, 19701204, 19780791, 19796686, 22323750, 22589250, 23651915, 24177143, 24579982, 25194489, 25485908, 26032921, 26773249, 27717669, 28142128, 29034879, 30034322, 30598502, 30813600, 31301272, 31432233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal Dominant Lateral Temporal Lobe Epilepsy	Lateral temporal lobe epilepsy	Pubtator	12023020, 12446220, 15079011, 15660777, 15946341, 16707245, 18711109, 19064878, 19780791, 22323750, 24177143	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal Dominant Lateral Temporal Lobe Epilepsy	Temporal lobe epilepsy	ORPHANET_DG	12601709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal Dominant Lateral Temporal Lobe Epilepsy	Temporal lobe epilepsy	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bohring syndrome	Bohring syndrome	Pubtator	12023020	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28431605		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12942323, 18575738, 9879993		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18575738	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28431605, 31129638		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27893017, 28431605		★☆☆☆☆ Found in Text Mining only
Complex partial seizure with impairment of consciousness	Dyscognitive seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	26459092, 30489685, 31276752		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30732585		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20659151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20659151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	26993267	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30338517		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	24920620, 27893017, 28026029, 28026046, 28081431, 28234800, 28418022, 28431605, 28476644, 28586706, 29093718, 29103007, 29145168, 29171405, 29195105, 29395322, 29501086, 29572931, 29886429, 29951031, 29980179, 30253786, 30332659, 30338517, 30530418, 30625332, 30714986, 30732585, 30955116, 31021956, 31129638, 31331752, 31352183, 31507515, 31782181, 31791436		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	30253786, 32849520, 35115410, 36973076, 37217310, 37644514	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	20580615		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	20659151, 31327507	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	LHGDN	11810107, 12771268, 15079010, 15079011		★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	15654555, 16518856, 16707245, 24721199, 25194487, 29723732		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	11810107, 11978770, 12601709, 14643004, 15654555, 15660777, 16190946, 16750938, 16990550, 17296837, 18711109, 19701204, 19796686, 19835947, 19853223, 20133599, 20659151, 20832659, 20863412, 21504429, 21829378, 22589250, 24177143, 25194487, 25194489, 25485908, 28670128, 29145168, 29491011, 29670100, 29723732, 30112956, 30332659, 30489685, 31020005, 31240596, 31432233		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	12217514, 15009222		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	15660777, 15946341, 16707245, 19835947, 20863412, 21504429, 24177143, 31020005	Associate	★☆☆☆☆ Found in Text Mining only
epilepsy and migraine	Epilepsy And Migraine	BEFREE	19268539		★☆☆☆☆ Found in Text Mining only
Epilepsy Generalized	Generalized epilepsy	Pubtator	15079011	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	15079011	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	12023020, 14510822, 15009222, 19552651, 20863412, 21479274, 21504429, 22496201, 23621105, 25243798, 28633043, 29034879	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Familial Temporal Lobe 1	Epilepsy	CLINVAR_DG	11810107, 11978770, 12205652, 12601709, 14510822, 15079010, 15079011, 15349881, 15857855, 18711109, 24206907, 26773249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Familial Temporal Lobe 1	Epilepsy	UNIPROT_DG	11810107, 12205652, 12601709, 12771268, 15079010, 17067999, 17296837, 17562837, 18625862, 19552651		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Familial Temporal Lobe 1	Epilepsy	BEFREE	15021241, 15660777, 15946341, 16190946, 19780791, 22589250, 24177143, 25194489, 26032921, 27717669, 30813600, 31432233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Familial Temporal Lobe 1	Epilepsy	GENOMICS_ENGLAND_DG	22496201		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Familial Temporal Lobe 1	Epilepsy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Generalized	Epilepsy	BEFREE	15079011, 17981785		★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	BEFREE	11978770, 12217514, 16787412, 17296837, 18625862, 19191227, 19268539, 21333500, 21504429, 22496201, 23621105, 25616465, 27760137, 29723732		★☆☆☆☆ Found in Text Mining only
Epilepsy, Partial, with Variable Foci	Epilepsy	BEFREE	25194487		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	11810107, 12023020, 15079010, 15660777, 16707245, 18355961, 19298753, 21444903, 29145168, 31301272		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	11978770, 12205652, 15079010		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	14598228		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	26459092		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	19552651	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	19780791		★☆☆☆☆ Found in Text Mining only
Generalized tonic-clonic seizures with focal onset	Bilateral convulsive seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11907806, 12942323, 16518856, 9879993		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11907806, 12942323, 16518856, 9879993		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11907806, 12942323, 15009222, 15047712, 15827762, 19780791, 23713523, 29723732, 30813600, 9879993		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12821932, 15047712, 15827762		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15047712	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19835947	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	15079011, 19064878, 22323750	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	15079011		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27893017, 28431605, 29171405, 29272336, 31432233		★☆☆☆☆ Found in Text Mining only
Isaacs syndrome	Isaacs Syndrome	BEFREE	28115470, 30242309, 30714278		★☆☆☆☆ Found in Text Mining only
Limbic encephalitis with leucine-rich glioma-inactivated 1 antibodies	Limbic encephalitis with LGI1 antibodies	BEFREE	29093718		★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	21479274	Associate	★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	29395322		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15827762, 9879993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	18575738		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14643004, 28628235		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20659151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20659151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	28919330		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	27262149, 30338517		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29395322		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30406135		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11508811, 11907806, 12942323, 14643004, 15827762, 20663977, 24510112, 29723732, 29980179, 30034322, 31352183, 9879993		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	31338588		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	LHGDN	12217514		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26046367, 30671012		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16518856		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28628235		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30001772		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31174586		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	12942323		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28363946, 31174586		★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	BEFREE	18215482		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	15009222, 15946341, 16707245, 19780791, 21504429, 29272336, 33453592	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28878050		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24510112		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	19552651	Associate	★☆☆☆☆ Found in Text Mining only
Subclinical Seizure	Subclinical Seizure	BEFREE	28586706		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28298428		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28628235		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	22589250		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	15079010		★☆☆☆☆ Found in Text Mining only
Visual auras	Visual auras	BEFREE	25616465		★☆☆☆☆ Found in Text Mining only