Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9201
Gene name	Doublecortin like kinase 1
Gene symbol	DCLK1
Synonyms (NCBI Gene)	CL1CLICK1DCAMKL1DCDC3ADCLK
Chromosome	13
Chromosome location	13q13.3
Summary	This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/t

354

Show/Hide all (354)

miRTarBase ID	miRNA	Experiments
MIRT926104	hsa-miR-1205	CLIP-seq
MIRT926105	hsa-miR-1276	CLIP-seq
MIRT926106	hsa-miR-143	CLIP-seq
MIRT926107	hsa-miR-217	CLIP-seq
MIRT926108	hsa-miR-3123	CLIP-seq
MIRT926109	hsa-miR-3136-5p	CLIP-seq
MIRT926110	hsa-miR-3158-5p	CLIP-seq
MIRT926111	hsa-miR-3662	CLIP-seq
MIRT926112	hsa-miR-3665	CLIP-seq
MIRT926113	hsa-miR-3925-5p	CLIP-seq
MIRT926114	hsa-miR-4418	CLIP-seq
MIRT926115	hsa-miR-4439	CLIP-seq
MIRT926116	hsa-miR-4453	CLIP-seq
MIRT926117	hsa-miR-4495	CLIP-seq
MIRT926118	hsa-miR-4538	CLIP-seq
MIRT926119	hsa-miR-455-3p	CLIP-seq
MIRT926120	hsa-miR-4645-3p	CLIP-seq
MIRT926121	hsa-miR-4756-3p	CLIP-seq
MIRT926122	hsa-miR-4770	CLIP-seq
MIRT926123	hsa-miR-4777-5p	CLIP-seq
MIRT926124	hsa-miR-509-3-5p	CLIP-seq
MIRT926125	hsa-miR-509-5p	CLIP-seq
MIRT926126	hsa-miR-518d-5p	CLIP-seq
MIRT926127	hsa-miR-519b-5p	CLIP-seq
MIRT926128	hsa-miR-519c-5p	CLIP-seq
MIRT926129	hsa-miR-520c-5p	CLIP-seq
MIRT926130	hsa-miR-526a	CLIP-seq
MIRT926131	hsa-miR-657	CLIP-seq
MIRT926132	hsa-miR-943	CLIP-seq
MIRT926133	hsa-miR-1207-3p	CLIP-seq
MIRT926134	hsa-miR-1237	CLIP-seq
MIRT926135	hsa-miR-1248	CLIP-seq
MIRT926136	hsa-miR-1299	CLIP-seq
MIRT926137	hsa-miR-2909	CLIP-seq
MIRT926138	hsa-miR-3162-5p	CLIP-seq
MIRT926139	hsa-miR-3646	CLIP-seq
MIRT926111	hsa-miR-3662	CLIP-seq
MIRT926140	hsa-miR-378	CLIP-seq
MIRT926141	hsa-miR-378b	CLIP-seq
MIRT926142	hsa-miR-378c	CLIP-seq
MIRT926143	hsa-miR-378d	CLIP-seq
MIRT926144	hsa-miR-378e	CLIP-seq
MIRT926145	hsa-miR-378f	CLIP-seq
MIRT926146	hsa-miR-378g	CLIP-seq
MIRT926147	hsa-miR-378h	CLIP-seq
MIRT926148	hsa-miR-378i	CLIP-seq
MIRT926149	hsa-miR-422a	CLIP-seq
MIRT926150	hsa-miR-4291	CLIP-seq
MIRT926151	hsa-miR-4310	CLIP-seq
MIRT926152	hsa-miR-4473	CLIP-seq
MIRT926153	hsa-miR-4511	CLIP-seq
MIRT926154	hsa-miR-4638-3p	CLIP-seq
MIRT926155	hsa-miR-4698	CLIP-seq
MIRT926156	hsa-miR-4738-3p	CLIP-seq
MIRT926157	hsa-miR-4782-5p	CLIP-seq
MIRT926158	hsa-miR-512-3p	CLIP-seq
MIRT926159	hsa-miR-516b	CLIP-seq
MIRT926160	hsa-miR-520d-5p	CLIP-seq
MIRT926161	hsa-miR-520f	CLIP-seq
MIRT926162	hsa-miR-524-5p	CLIP-seq
MIRT926163	hsa-miR-548b-3p	CLIP-seq
MIRT926164	hsa-miR-105	CLIP-seq
MIRT926165	hsa-miR-1291	CLIP-seq
MIRT926166	hsa-miR-1305	CLIP-seq
MIRT926167	hsa-miR-146b-3p	CLIP-seq
MIRT926168	hsa-miR-216a	CLIP-seq
MIRT926169	hsa-miR-3121-3p	CLIP-seq
MIRT926170	hsa-miR-3671	CLIP-seq
MIRT926171	hsa-miR-3976	CLIP-seq
MIRT926172	hsa-miR-4719	CLIP-seq
MIRT926173	hsa-miR-4755-3p	CLIP-seq
MIRT926174	hsa-miR-4760-5p	CLIP-seq
MIRT926175	hsa-miR-486-5p	CLIP-seq
MIRT926176	hsa-miR-548c-3p	CLIP-seq
MIRT926177	hsa-miR-607	CLIP-seq
MIRT926178	hsa-miR-668	CLIP-seq
MIRT1974375	hsa-miR-2467-3p	CLIP-seq
MIRT926110	hsa-miR-3158-5p	CLIP-seq
MIRT1974376	hsa-miR-3173-5p	CLIP-seq
MIRT1974377	hsa-miR-3663-3p	CLIP-seq
MIRT1974378	hsa-miR-3678-3p	CLIP-seq
MIRT1974379	hsa-miR-4446-5p	CLIP-seq
MIRT2209818	hsa-miR-1244	CLIP-seq
MIRT2209819	hsa-miR-1252	CLIP-seq
MIRT2209820	hsa-miR-1283	CLIP-seq
MIRT2209821	hsa-miR-140-3p	CLIP-seq
MIRT2209822	hsa-miR-155	CLIP-seq
MIRT2209823	hsa-miR-181a	CLIP-seq
MIRT2209824	hsa-miR-181b	CLIP-seq
MIRT2209825	hsa-miR-181c	CLIP-seq
MIRT2209826	hsa-miR-181d	CLIP-seq
MIRT2209827	hsa-miR-199a-3p	CLIP-seq
MIRT2209828	hsa-miR-199b-3p	CLIP-seq
MIRT2209829	hsa-miR-21	CLIP-seq
MIRT926107	hsa-miR-217	CLIP-seq
MIRT2209830	hsa-miR-23a	CLIP-seq
MIRT2209831	hsa-miR-23b	CLIP-seq
MIRT2209832	hsa-miR-23c	CLIP-seq
MIRT2209833	hsa-miR-3117-5p	CLIP-seq
MIRT2209834	hsa-miR-3129-5p	CLIP-seq
MIRT926109	hsa-miR-3136-5p	CLIP-seq
MIRT2209835	hsa-miR-3157-5p	CLIP-seq
MIRT926110	hsa-miR-3158-5p	CLIP-seq
MIRT2209836	hsa-miR-3159	CLIP-seq
MIRT2209837	hsa-miR-365	CLIP-seq
MIRT2209838	hsa-miR-3660	CLIP-seq
MIRT2209839	hsa-miR-3668	CLIP-seq
MIRT2209840	hsa-miR-3921	CLIP-seq
MIRT2209841	hsa-miR-3924	CLIP-seq
MIRT2209842	hsa-miR-412	CLIP-seq
MIRT2209843	hsa-miR-4262	CLIP-seq
MIRT926114	hsa-miR-4418	CLIP-seq
MIRT2209844	hsa-miR-4436a	CLIP-seq
MIRT926115	hsa-miR-4439	CLIP-seq
MIRT926116	hsa-miR-4453	CLIP-seq
MIRT2209845	hsa-miR-4502	CLIP-seq
MIRT2209846	hsa-miR-4513	CLIP-seq
MIRT2209847	hsa-miR-4526	CLIP-seq
MIRT926118	hsa-miR-4538	CLIP-seq
MIRT926120	hsa-miR-4645-3p	CLIP-seq
MIRT2209848	hsa-miR-4653-5p	CLIP-seq
MIRT2209849	hsa-miR-4666-5p	CLIP-seq
MIRT2209850	hsa-miR-4691-3p	CLIP-seq
MIRT2209851	hsa-miR-485-3p	CLIP-seq
MIRT926124	hsa-miR-509-3-5p	CLIP-seq
MIRT926125	hsa-miR-509-5p	CLIP-seq
MIRT926160	hsa-miR-520d-5p	CLIP-seq
MIRT926162	hsa-miR-524-5p	CLIP-seq
MIRT2209852	hsa-miR-548ac	CLIP-seq
MIRT2209853	hsa-miR-548d-3p	CLIP-seq
MIRT2209854	hsa-miR-548z	CLIP-seq
MIRT2209855	hsa-miR-569	CLIP-seq
MIRT2209856	hsa-miR-570	CLIP-seq
MIRT2209857	hsa-miR-590-5p	CLIP-seq
MIRT2209858	hsa-miR-767-5p	CLIP-seq
MIRT2209859	hsa-miR-936	CLIP-seq
MIRT926132	hsa-miR-943	CLIP-seq
MIRT926133	hsa-miR-1207-3p	CLIP-seq
MIRT926146	hsa-miR-378g	CLIP-seq
MIRT2448084	hsa-miR-1249	CLIP-seq
MIRT2448085	hsa-miR-3187-3p	CLIP-seq
MIRT2448086	hsa-miR-3681	CLIP-seq
MIRT2448087	hsa-miR-4435	CLIP-seq
MIRT2448088	hsa-miR-4701-5p	CLIP-seq
MIRT2448089	hsa-miR-548s	CLIP-seq
MIRT2448090	hsa-miR-588	CLIP-seq
MIRT2513589	hsa-miR-103a	CLIP-seq
MIRT2513590	hsa-miR-107	CLIP-seq
MIRT926104	hsa-miR-1205	CLIP-seq
MIRT2513591	hsa-miR-1206	CLIP-seq
MIRT2513592	hsa-miR-1208	CLIP-seq
MIRT2513593	hsa-miR-1226	CLIP-seq
MIRT2513594	hsa-miR-1231	CLIP-seq
MIRT926134	hsa-miR-1237	CLIP-seq
MIRT926135	hsa-miR-1248	CLIP-seq
MIRT2513595	hsa-miR-125a-5p	CLIP-seq
MIRT2513596	hsa-miR-125b	CLIP-seq
MIRT2513597	hsa-miR-1273d	CLIP-seq
MIRT2513598	hsa-miR-1286	CLIP-seq
MIRT926136	hsa-miR-1299	CLIP-seq
MIRT2513599	hsa-miR-139-5p	CLIP-seq
MIRT926106	hsa-miR-143	CLIP-seq
MIRT2513600	hsa-miR-15a	CLIP-seq
MIRT2513601	hsa-miR-15b	CLIP-seq
MIRT2513602	hsa-miR-16	CLIP-seq
MIRT2209823	hsa-miR-181a	CLIP-seq
MIRT2209824	hsa-miR-181b	CLIP-seq
MIRT2209825	hsa-miR-181c	CLIP-seq
MIRT2209826	hsa-miR-181d	CLIP-seq
MIRT2513603	hsa-miR-190	CLIP-seq
MIRT2513604	hsa-miR-190b	CLIP-seq
MIRT2513605	hsa-miR-1912	CLIP-seq
MIRT2513606	hsa-miR-195	CLIP-seq
MIRT2513607	hsa-miR-1972	CLIP-seq
MIRT2513608	hsa-miR-204	CLIP-seq
MIRT2209829	hsa-miR-21	CLIP-seq
MIRT2513609	hsa-miR-211	CLIP-seq
MIRT2513610	hsa-miR-218	CLIP-seq
MIRT2513611	hsa-miR-221	CLIP-seq
MIRT2513612	hsa-miR-222	CLIP-seq
MIRT2513613	hsa-miR-223	CLIP-seq
MIRT2209830	hsa-miR-23a	CLIP-seq
MIRT2209831	hsa-miR-23b	CLIP-seq
MIRT2209832	hsa-miR-23c	CLIP-seq
MIRT2513614	hsa-miR-3065-3p	CLIP-seq
MIRT2209833	hsa-miR-3117-5p	CLIP-seq
MIRT926109	hsa-miR-3136-5p	CLIP-seq
MIRT2513615	hsa-miR-3150a-3p	CLIP-seq
MIRT2513616	hsa-miR-3154	CLIP-seq
MIRT2513617	hsa-miR-3156-5p	CLIP-seq
MIRT2513618	hsa-miR-3161	CLIP-seq
MIRT2513619	hsa-miR-3163	CLIP-seq
MIRT2513620	hsa-miR-3175	CLIP-seq
MIRT2513621	hsa-miR-33a	CLIP-seq
MIRT2513622	hsa-miR-33b	CLIP-seq
MIRT2513623	hsa-miR-3607-5p	CLIP-seq
MIRT2513624	hsa-miR-3613-3p	CLIP-seq
MIRT2513625	hsa-miR-3618	CLIP-seq
MIRT2513626	hsa-miR-3647-3p	CLIP-seq
MIRT2513627	hsa-miR-3653	CLIP-seq
MIRT2513628	hsa-miR-3658	CLIP-seq
MIRT926111	hsa-miR-3662	CLIP-seq
MIRT2513629	hsa-miR-3688-3p	CLIP-seq
MIRT2513630	hsa-miR-375	CLIP-seq
MIRT926140	hsa-miR-378	CLIP-seq
MIRT926141	hsa-miR-378b	CLIP-seq
MIRT926142	hsa-miR-378c	CLIP-seq
MIRT926143	hsa-miR-378d	CLIP-seq
MIRT926144	hsa-miR-378e	CLIP-seq
MIRT926145	hsa-miR-378f	CLIP-seq
MIRT926147	hsa-miR-378h	CLIP-seq
MIRT926148	hsa-miR-378i	CLIP-seq
MIRT2513631	hsa-miR-3919	CLIP-seq
MIRT2513632	hsa-miR-3920	CLIP-seq
MIRT2513633	hsa-miR-3938	CLIP-seq
MIRT2513634	hsa-miR-409-3p	CLIP-seq
MIRT926149	hsa-miR-422a	CLIP-seq
MIRT2513635	hsa-miR-424	CLIP-seq
MIRT2209843	hsa-miR-4262	CLIP-seq
MIRT2513636	hsa-miR-4273	CLIP-seq
MIRT2513637	hsa-miR-4282	CLIP-seq
MIRT2513638	hsa-miR-4287	CLIP-seq
MIRT2513639	hsa-miR-4288	CLIP-seq
MIRT926150	hsa-miR-4291	CLIP-seq
MIRT926151	hsa-miR-4310	CLIP-seq
MIRT2513640	hsa-miR-4312	CLIP-seq
MIRT2513641	hsa-miR-4319	CLIP-seq
MIRT2513642	hsa-miR-4324	CLIP-seq
MIRT2513643	hsa-miR-4436b-5p	CLIP-seq
MIRT926115	hsa-miR-4439	CLIP-seq
MIRT2513644	hsa-miR-4469	CLIP-seq
MIRT2513645	hsa-miR-4476	CLIP-seq
MIRT2513646	hsa-miR-4477a	CLIP-seq
MIRT2513647	hsa-miR-450b-3p	CLIP-seq
MIRT2513648	hsa-miR-4517	CLIP-seq
MIRT2513649	hsa-miR-452	CLIP-seq
MIRT2513650	hsa-miR-4524	CLIP-seq
MIRT926154	hsa-miR-4638-3p	CLIP-seq
MIRT2513651	hsa-miR-4643	CLIP-seq
MIRT2513652	hsa-miR-4676-3p	CLIP-seq
MIRT2513653	hsa-miR-4677-5p	CLIP-seq
MIRT2513654	hsa-miR-4685-3p	CLIP-seq
MIRT2513655	hsa-miR-4693-3p	CLIP-seq
MIRT2513656	hsa-miR-4697-3p	CLIP-seq
MIRT2513657	hsa-miR-4713-3p	CLIP-seq
MIRT2513658	hsa-miR-4715-3p	CLIP-seq
MIRT2513659	hsa-miR-4717-5p	CLIP-seq
MIRT2513660	hsa-miR-4722-5p	CLIP-seq
MIRT2513661	hsa-miR-4728-3p	CLIP-seq
MIRT2513662	hsa-miR-4731-5p	CLIP-seq
MIRT2513663	hsa-miR-4732-3p	CLIP-seq
MIRT2513664	hsa-miR-4733-3p	CLIP-seq
MIRT2513665	hsa-miR-4746-5p	CLIP-seq
MIRT2513666	hsa-miR-4755-5p	CLIP-seq
MIRT926121	hsa-miR-4756-3p	CLIP-seq
MIRT926122	hsa-miR-4770	CLIP-seq
MIRT2513667	hsa-miR-4773	CLIP-seq
MIRT2513668	hsa-miR-4780	CLIP-seq
MIRT926157	hsa-miR-4782-5p	CLIP-seq
MIRT2513669	hsa-miR-4790-3p	CLIP-seq
MIRT2513670	hsa-miR-4797-5p	CLIP-seq
MIRT2513671	hsa-miR-4799-5p	CLIP-seq
MIRT2513672	hsa-miR-497	CLIP-seq
MIRT2513673	hsa-miR-503	CLIP-seq
MIRT2513674	hsa-miR-509-3p	CLIP-seq
MIRT926159	hsa-miR-516b	CLIP-seq
MIRT2513675	hsa-miR-532-5p	CLIP-seq
MIRT2513676	hsa-miR-539	CLIP-seq
MIRT2513677	hsa-miR-543	CLIP-seq
MIRT2513678	hsa-miR-544	CLIP-seq
MIRT2513679	hsa-miR-548v	CLIP-seq
MIRT2513680	hsa-miR-550b	CLIP-seq
MIRT2209856	hsa-miR-570	CLIP-seq
MIRT2513681	hsa-miR-580	CLIP-seq
MIRT2209857	hsa-miR-590-5p	CLIP-seq
MIRT2513682	hsa-miR-592	CLIP-seq
MIRT2513683	hsa-miR-597	CLIP-seq
MIRT2513684	hsa-miR-621	CLIP-seq
MIRT2513685	hsa-miR-623	CLIP-seq
MIRT2513686	hsa-miR-632	CLIP-seq
MIRT2513687	hsa-miR-636	CLIP-seq
MIRT2513688	hsa-miR-638	CLIP-seq
MIRT2513689	hsa-miR-646	CLIP-seq
MIRT926131	hsa-miR-657	CLIP-seq
MIRT2513690	hsa-miR-659	CLIP-seq
MIRT2513691	hsa-miR-664	CLIP-seq
MIRT2513692	hsa-miR-670	CLIP-seq
MIRT2513693	hsa-miR-671-5p	CLIP-seq
MIRT2513694	hsa-miR-769-3p	CLIP-seq
MIRT2513695	hsa-miR-888	CLIP-seq
MIRT2513696	hsa-miR-889	CLIP-seq
MIRT2513697	hsa-miR-934	CLIP-seq
MIRT2513698	hsa-miR-939	CLIP-seq
MIRT926132	hsa-miR-943	CLIP-seq
MIRT2513591	hsa-miR-1206	CLIP-seq
MIRT2513592	hsa-miR-1208	CLIP-seq
MIRT926134	hsa-miR-1237	CLIP-seq
MIRT926135	hsa-miR-1248	CLIP-seq
MIRT2513595	hsa-miR-125a-5p	CLIP-seq
MIRT2513596	hsa-miR-125b	CLIP-seq
MIRT2209823	hsa-miR-181a	CLIP-seq
MIRT2209824	hsa-miR-181b	CLIP-seq
MIRT2209825	hsa-miR-181c	CLIP-seq
MIRT2209826	hsa-miR-181d	CLIP-seq
MIRT2513608	hsa-miR-204	CLIP-seq
MIRT2209829	hsa-miR-21	CLIP-seq
MIRT2513609	hsa-miR-211	CLIP-seq
MIRT2513611	hsa-miR-221	CLIP-seq
MIRT2513612	hsa-miR-222	CLIP-seq
MIRT2209830	hsa-miR-23a	CLIP-seq
MIRT2209831	hsa-miR-23b	CLIP-seq
MIRT2209832	hsa-miR-23c	CLIP-seq
MIRT2209833	hsa-miR-3117-5p	CLIP-seq
MIRT926109	hsa-miR-3136-5p	CLIP-seq
MIRT2513619	hsa-miR-3163	CLIP-seq
MIRT2513621	hsa-miR-33a	CLIP-seq
MIRT2513622	hsa-miR-33b	CLIP-seq
MIRT2513626	hsa-miR-3647-3p	CLIP-seq
MIRT926111	hsa-miR-3662	CLIP-seq
MIRT2513632	hsa-miR-3920	CLIP-seq
MIRT2513633	hsa-miR-3938	CLIP-seq
MIRT2513634	hsa-miR-409-3p	CLIP-seq
MIRT2209843	hsa-miR-4262	CLIP-seq
MIRT2513637	hsa-miR-4282	CLIP-seq
MIRT926150	hsa-miR-4291	CLIP-seq
MIRT926151	hsa-miR-4310	CLIP-seq
MIRT2513641	hsa-miR-4319	CLIP-seq
MIRT2513643	hsa-miR-4436b-5p	CLIP-seq
MIRT926115	hsa-miR-4439	CLIP-seq
MIRT2513648	hsa-miR-4517	CLIP-seq
MIRT2513649	hsa-miR-452	CLIP-seq
MIRT2513652	hsa-miR-4676-3p	CLIP-seq
MIRT2513663	hsa-miR-4732-3p	CLIP-seq
MIRT2513666	hsa-miR-4755-5p	CLIP-seq
MIRT2513668	hsa-miR-4780	CLIP-seq
MIRT2513674	hsa-miR-509-3p	CLIP-seq
MIRT926159	hsa-miR-516b	CLIP-seq
MIRT2513676	hsa-miR-539	CLIP-seq
MIRT2513678	hsa-miR-544	CLIP-seq
MIRT2513679	hsa-miR-548v	CLIP-seq
MIRT2513680	hsa-miR-550b	CLIP-seq
MIRT2513681	hsa-miR-580	CLIP-seq
MIRT2209857	hsa-miR-590-5p	CLIP-seq
MIRT2513685	hsa-miR-623	CLIP-seq
MIRT2513689	hsa-miR-646	CLIP-seq
MIRT2513691	hsa-miR-664	CLIP-seq
MIRT2513692	hsa-miR-670	CLIP-seq
MIRT2513695	hsa-miR-888	CLIP-seq
MIRT2513696	hsa-miR-889	CLIP-seq
MIRT2513697	hsa-miR-934	CLIP-seq
MIRT926132	hsa-miR-943	CLIP-seq
MIRT2209840	hsa-miR-3921	CLIP-seq
MIRT2209848	hsa-miR-4653-5p	CLIP-seq
MIRT2513689	hsa-miR-646	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9747029
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33199366
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	TAS	10036192
GO:0006468	Process	Protein phosphorylation	TAS	9747029
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	10036192
GO:0007417	Process	Central nervous system development	IEA
GO:0007417	Process	Central nervous system development	TAS	10051403
GO:0009615	Process	Response to virus	IEP	16548883
GO:0016197	Process	Endosomal transport	NAS	14613930
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0034504	Process	Protein localization to nucleus	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0048675	Process	Axon extension	IBA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
604742	2700	ENSG00000133083

O15075

Protein name

Serine/threonine-protein kinase DCLK1 (EC 2.7.11.1) (Doublecortin domain-containing protein 3A) (Doublecortin-like and CAM kinase-like 1) (Doublecortin-like kinase 1)

Protein function

Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system.

PDB

1MFW , 1MG4 , 1UF0 , 5JZJ , 5JZN , 6KYQ , 6KYR , 7F3G , 7KX6 , 7KX8 , 7KXW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03607	DCX	75 → 137	Doublecortin	Family
PF03607	DCX	204 → 263	Doublecortin	Family
PF00069	Pkinase	390 → 647	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: In fetal tissues, highly expressed in brain, detectable in lung and liver, but not in kidney. In adult tissues, expressed ubiquitously in the brain, detectable in the heart, liver, spleen, thymus, prostate, testis, ovary, small intesti

Sequence

MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVR
FYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSL
DQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENK
DFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGVVKRLYTLDGK
QVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPG
PSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTK
VCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITST
NKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIV
DGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQ
ILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLS
VAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNS
ESEDYSPSSSETVRSPNSPF

Sequence length

740

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT INFECTIOUS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY OF PREMATURITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (132)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	25228975, 25266024, 25347154, 28148261, 28382517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	28148261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25266024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21285251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19445940, 28851816, 29254234, 29475922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	29475922		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24040120, 25723399, 28883702, 31442435, 31467540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22539971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	22539971, 30208879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	12826745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21916995, 25283374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	25266024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29535532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22539971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22539971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28621231, 31028726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	36728938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31223610, 31773701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26621833, 31223610, 31773701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28851816, 31636360, 37762326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25228975, 27470117, 28946555, 31028726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28621231, 31028726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26311076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22797009, 28883702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25605241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28161486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23117657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22983262, 24948044, 32978808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26311076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	30478383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26468984, 29344199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22539971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30478383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26747706, 28414327, 31040926, 31562741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	28851816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28851816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31040926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	29475922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19414319, 19445940, 24384857, 24948044, 25605241, 25631749, 26311076, 27470117, 27520310, 27966796, 28148261, 28414327, 28851816, 29254234, 29277893 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	23202126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	23202126		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24384857, 24885928, 24948044, 25599653, 25605241, 25631749, 26383518, 28414327, 28851816, 31636360, 32671503, 33268966, 34958000, 37998393	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	28414327		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25605241, 29577277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35404759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28161486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25266024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25266024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	21916995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	28179411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24885928, 26621833, 27287716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	31837335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29845210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22584021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31706685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	31707728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	32572888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	22539971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35130915	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	24384857, 26527802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	24384857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	26527802, 28382517, 30001952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	28179411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	12826745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30453285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	24454846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21937640, 25948779, 26468984, 27049311, 29344199, 31654063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26468984, 29344199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35943255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21937640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	22584021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27520310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28621231	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	22539971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31706685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31223610, 31773701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25266024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29577277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26311076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21285251, 24040120, 25723399, 26447334, 26764906, 28244691, 29048622, 29224010, 30453285, 31442435, 31837335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28382517, 29535532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27545623, 30702489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28621231, 31028726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21937640, 24260365, 24384857, 25605241, 26468984, 26527802, 27470117, 27966796, 28148261, 28179411, 28351564, 28382517, 28621231, 28883702, 29048622 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25599653, 26447334, 26747706, 28414327, 31040926, 31562741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22539971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28560410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28560410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28560410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19445940, 21383077, 22411066, 25605241, 25723399, 25948779, 26468984, 27049311, 27388564, 28148261, 28161486, 28179411, 28351564, 28382517, 28560410 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	34573300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21971288, 28179411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32495887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	28179411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28179411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28382517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	28351564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	25605241	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28161486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37838282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21285251, 24040120, 25723399, 26764906, 28244691, 29048622, 29224010, 30453285, 31442435, 31837335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25723399, 28883702, 31442435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29344199, 31837335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22797009, 25283374, 27287716, 28244691, 28883702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28244691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29526803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	29475922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29535532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26990456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29924454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29577277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29577277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22539971, 30208879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22539971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22539971	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28320089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28351564, 31706685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25228975, 28946555, 30702489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28946555, 30702489, 32423385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32406563, 37069669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28621231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DCLK1 (doublecortin like kinase 1)