CD4 (CD4 molecule)

Gene

• Entrez ID: 920
• Gene name: CD4 molecule
• Gene symbol: CD4
• Synonyms (NCBI Gene): CD4mut, IMD79, Leu-3, OKT4D, T4
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28919570	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053201	hsa-miR-181a-5p	Flow, qRT-PCR, Western blot	23393335
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT733042	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT736025	hsa-miR-125b-5p	Microarray, qRT-PCR	33179091
MIRT736029	hsa-miR-155-5p	Microarray, qRT-PCR	33179091
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT875411	hsa-miR-1254	CLIP-seq
MIRT875412	hsa-miR-1321	CLIP-seq
MIRT875413	hsa-miR-3116	CLIP-seq
MIRT875414	hsa-miR-3151	CLIP-seq
MIRT875415	hsa-miR-3176	CLIP-seq
MIRT875416	hsa-miR-3919	CLIP-seq
MIRT875417	hsa-miR-3922-3p	CLIP-seq
MIRT875418	hsa-miR-4447	CLIP-seq
MIRT875419	hsa-miR-4455	CLIP-seq
MIRT875420	hsa-miR-4472	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875422	hsa-miR-4654	CLIP-seq
MIRT875423	hsa-miR-4712-3p	CLIP-seq
MIRT875424	hsa-miR-4728-5p	CLIP-seq
MIRT875425	hsa-miR-4739	CLIP-seq
MIRT875426	hsa-miR-4756-3p	CLIP-seq
MIRT875427	hsa-miR-4756-5p	CLIP-seq
MIRT875428	hsa-miR-4757-5p	CLIP-seq
MIRT875429	hsa-miR-4769-5p	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875431	hsa-miR-491-5p	CLIP-seq
MIRT875432	hsa-miR-539	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875434	hsa-miR-661	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT875436	hsa-miR-1256	CLIP-seq
MIRT875437	hsa-miR-2355-3p	CLIP-seq
MIRT875438	hsa-miR-3140-5p	CLIP-seq
MIRT875439	hsa-miR-3688-5p	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875440	hsa-miR-4527	CLIP-seq
MIRT875441	hsa-miR-4646-3p	CLIP-seq
MIRT875442	hsa-miR-4710	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875443	hsa-miR-4790-3p	CLIP-seq
MIRT875444	hsa-miR-4792	CLIP-seq
MIRT875445	hsa-miR-516b	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875446	hsa-miR-644	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT1959526	hsa-miR-1302	CLIP-seq
MIRT1959527	hsa-miR-1827	CLIP-seq
MIRT1959528	hsa-miR-3150a-3p	CLIP-seq
MIRT1959529	hsa-miR-3175	CLIP-seq
MIRT1959530	hsa-miR-4298	CLIP-seq
MIRT1959531	hsa-miR-4667-5p	CLIP-seq
MIRT1959532	hsa-miR-4700-5p	CLIP-seq
MIRT1959533	hsa-miR-939	CLIP-seq
MIRT2677705	hsa-miR-1224-3p	CLIP-seq
MIRT2677706	hsa-miR-1260	CLIP-seq
MIRT2677707	hsa-miR-1260b	CLIP-seq
MIRT2677708	hsa-miR-1280	CLIP-seq
MIRT2677709	hsa-miR-4281	CLIP-seq
MIRT2677710	hsa-miR-627	CLIP-seq
MIRT2677711	hsa-miR-924	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	9765424
EIF2AK2	Unknown	8995707
HES1	Repression	11287612
MAZ	Unknown	7760814
MYB	Repression	11287612
TCF3	Unknown	17486074

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	9641677
GO:0001618	Function	Virus receptor activity	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002684	Process	Positive regulation of immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10358157
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005201	Function	Extracellular matrix structural constituent	NAS	12444132
GO:0005515	Function	Protein binding	IPI	7831289, 9168119, 10816381, 10922058, 11113139, 11264384, 15660419, 16888650, 17005671, 17301785, 19333378, 20080564, 20357769, 23890821, 26098315, 27114505, 30542158, 32814053
GO:0005769	Component	Early endosome	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	2823150, 8124721, 11390434, 19333378, 24942581
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	8512039
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	9558100, 10358157
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9780207
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	TAS	10358157
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	NAS	8512039
GO:0008270	Function	Zinc ion binding	IDA	9668045
GO:0008289	Function	Lipid binding	EXP	9622505, 19781520
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	NAS	8512039
GO:0015026	Function	Coreceptor activity	TAS	8674120
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019865	Function	Immunoglobulin binding	IEA
GO:0019899	Function	Enzyme binding	IPI	19333378
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	7486703
GO:0023026	Function	MHC class II protein complex binding	IDA	27114505
GO:0030217	Process	T cell differentiation	IDA	1533274
GO:0030225	Process	Macrophage differentiation	IMP	24942581
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0032355	Process	Response to estradiol	IEA
GO:0032507	Process	Maintenance of protein location in cell	IDA	15128768
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	1901411
GO:0033280	Process	Response to vitamin D	IEA
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0035397	Process	Helper T cell enhancement of adaptive immune response	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	24942581
GO:0038023	Function	Signaling receptor activity	TAS	10413516
GO:0042011	Function	Interleukin-16 binding	IPI	24942581
GO:0042012	Function	Interleukin-16 receptor activity	IDA	24942581
GO:0042101	Component	T cell receptor complex	NAS	8512039
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042289	Function	MHC class II protein binding	IDA	2823150, 11535811
GO:0042289	Function	MHC class II protein binding	IPI	24942581
GO:0042289	Function	MHC class II protein binding	NAS	8512039
GO:0042802	Function	Identical protein binding	IPI	9168119
GO:0042803	Function	Protein homodimerization activity	IDA	9168119, 12444132
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24942581
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0045058	Process	T cell selection	IDA	9551897
GO:0045121	Component	Membrane raft	IDA	9168119
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	2118992
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24942581
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0046718	Process	Symbiont entry into host cell	IDA	9641677
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050863	Process	Regulation of T cell activation	IDA	1533274
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051924	Process	Regulation of calcium ion transport	IDA	24942581
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	24942581
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	24942581
GO:1904313	Process	Response to methamphetamine hydrochloride	IEA
GO:1904637	Process	Cellular response to ionomycin	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	3262426

Other IDs

• MIM: 186940
• HGNC: 1678
• e!Ensembl: ENSG00000010610

Protein

• UniProt ID: P01730
• Protein name: T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)
• Protein function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:
• PDB: 1CDH, 1CDI, 1CDJ, 1CDU, 1CDY, 1G9M, 1G9N, 1GC1, 1JL4, 1Q68, 1RZJ, 1RZK, 1WBR, 1WIO, 1WIP, 1WIQ, 2B4C, 2JKR, 2JKT, 2KLU, 2NXY, 2NXZ, 2NY0, 2NY1, 2NY2, 2NY3, 2NY4, 2NY5, 2NY6, 2QAD, 3B71, 3CD4, 3J70, 3JCB, 3JCC, 3JWD, 3JWO, 3LQA, 3O2D, 3S4S, 3S5L, 3T0E, 4H8W, 4JM2, 4P9H, 4Q6I, 4R2G, 4R4H, 4RQS, 5A7X, 5A8H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	24 → 123	Immunoglobulin domain	Domain
  PF05790	C2-set	125 → 203	Immunoglobulin C2-set domain	Domain
  PF09191	CD4-extracel	206 → 316	CD4, extracellular	Domain
  PF05790	C2-set	317 → 390	Immunoglobulin C2-set domain	Domain
  PF12104	Tcell_CD4_C	425 → 453	T cell CD4 receptor C terminal region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in T-helper cells. The presence of CD4 is a hallmark of T-helper cells which are specialized in the activation and growth of cytotoxic T-cells, regulation of B cells, or activation of phagocytes. CD4 is also present in
• Sequence:

  MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
  ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
  LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
  TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
  QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
  LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
  LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
  RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI

• Sequence length: 458

Pathways

KEGG:

Viral life cycle - HIV-1
Virion - Human immunodeficiency virus
Cytokine-cytokine receptor interaction
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Yersinia infection
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency

Reactome:

Alpha-defensins
Nef Mediated CD4 Down-regulation
Binding and entry of HIV virion
Vpu mediated degradation of CD4
Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
Other interleukin signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 79	Pathogenic	rs782212142, rs200294737	RCV001353064 RCV001353065	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CD4-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Okt4 epitope deficiency	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34531868	Associate	★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	25926555, 31445098, 33228556, 35611411	Associate	★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	23092122	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	10337028	Stimulate	★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	19842835, 27792269	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23824053, 25197660, 34001857, 34804058, 35279225, 36246562, 37545529, 38301877, 39388354, 39523385, 39657893, 40560886	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25072319	Inhibit	★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	20065129	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis Primary Cutaneous	Amyloidosis	Pubtator	9347791	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28973548	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25904736, 28426727	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11544283, 14675414, 15345281, 17463169, 1827129, 21506940, 22138514, 22797698, 24528288, 24845454, 26354756, 26764034, 28831064, 30889317, 32761514, 33785863, 9160674	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	12404285	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	32267841	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	1700620, 30686933	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	28260995	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	16799237, 24453425	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	12393451, 18034765	Associate	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33747255	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	10643701, 11535526, 11895785, 25862984, 28193831, 30872365	Associate	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	16757590, 23900552	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	16297165	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	16297165, 1700620, 29716755, 30686933, 39586133	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	30810667, 30957625, 37883426	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	32078016	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	34202072, 39991758	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	30810667	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	20130127	Associate	★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	24223933	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21248258, 25113810, 27849614, 29193869, 33291545, 34108969, 35130317, 38123480	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	30327490	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15743472, 15939793, 17374135, 18576332, 20127724, 21381000, 21702013, 21739422, 24470328, 25092890, 25833190, 26387944, 30089725, 33597588, 37445800, 37741520, 8093436	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	36793127	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11160357, 16277694, 24286492, 24470327, 25113810, 28245522, 29112182, 31727095, 33452865, 34108969, 34309834, 34681660, 35087513, 39711043, 39930543, 39991156	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10640771, 15547094, 17425604	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10403931, 10513808, 10700427, 10728756, 11056676, 11207664, 11803732, 12115225, 12393721, 12428227, 12591902, 12695561, 12699431, 12847680, 12878725, 1347492, 1386608, 14726963, 15140775, 15457445, 15498047, 15535835, 15880821, 15899036, 15934068, 16200579, 16220542, 16277694, 16537805, 16838043, 17109473, 17200409, 17328044, 17565371, 17665008, 17907166, 18353171, 18512781, 19255426, 19394279, 19479869, 19843577, 19886735, 19904767, 20459811, 20465565, 20658292, 20727150, 20738421, 20824142, 20929536, 21155991, 21204897, 21314928, 22488116, 22532634, 22594821, 22649468, 23263488, 23280063, 23494522, 23619188, 24019115, 24022618, 24043759, 24313359, 24452947, 24742142, 24959711, 24968232, 25164131, 25433812, 25649145, 25738173, 25880754, 25960619, 26091715, 26147876, 26245356, 26314565, 26464634, 26604133, 27241313, 27314557, 27385284, 27434862, 27667787, 27700100, 27723282, 27915349, 28150777, 28253537, 28282368, 28535889, 28569167, 28751821, 29112182, 29193869, 29388193, 29472917, 29563614, 30106887, 30333237, 30402903, 30611306, 30753680, 30990587, 31006511, 31333666, 31338093, 31405169, 31727095, 31945409, 32111105, 32117312, 32264938, 32961930, 33117342, 33193313, 33362761, 33507149, 33799480, 34079550, 34108969, 34369364, 34580414, 34867944, 35023427, 35085847, 35523821, 35706043, 35967356, 36012570, 36062760, 36851682, 36902005, 37344505, 37809066, 37934808, 38216287, 39261837, 39290322, 39586747, 7683586, 7962553, 8621791, 8872162, 8898376, 9260157, 9301522, 9409647, 9754554, 9767455, 9826720	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10922071, 24223933, 30413189, 37647423	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14691302, 23165362, 28358698, 30052100, 31205958, 33291545, 35848477	Stimulate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	34022844	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10596698, 10691908, 11510804, 17349011, 17409322, 17460949, 18250971, 18581330, 18832695, 19152963, 19610265, 21197090, 21469087, 21473777, 23893806, 24641294, 24934276, 26276877, 27230446, 27708065, 27848966, 27902892, 29297467, 29809062, 30087444, 30537802, 30644695, 32292999, 32532832, 33271553, 34576307, 34721414, 35029177, 35817495, 36194662, 36611927, 37431194, 38129444, 39745770, 39868576, 40551049, 9657564	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	10606975, 11427422, 14563948, 1972177, 20448385, 23264026, 2851398, 31866622, 34248969, 38155568	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15731463, 17526997, 19406979, 20495843, 21677140, 22313962, 23469279, 24347824, 24453425, 25814626, 26383248, 26822994, 30872365, 32229536, 35428200, 35842645, 36820569, 36855107, 37881939	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24385687	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25810125, 35485359, 35600045	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31591744	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37108638	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10400799, 10583274, 10739333, 11298351, 11390436, 11516335, 11602626, 11675346, 16424227, 16836768, 16917003, 17183685, 17463169, 17665008, 18000051, 18326816, 18490707, 18599794, 19074986, 19155519, 19162554, 19220836, 19283780, 19350181, 19604266, 20045101, 20370571, 20465565, 20498357, 21297967, 21508257, 21606346, 21926348, 21959269, 22461703, 22489829, 23432692, 23739916, 24376757, 24589341, 24968232, 25451162, 25556651, 25629163, 25824483, 25884400, 25894502, 26063731, 26106896, 26486970, 26764034, 27211045, 27619682, 27727279, 28150777, 28248954, 28253537, 28336414, 28393080, 28870212, 29066174, 29626493, 30632146, 31119949, 31205958, 31471951, 31612695, 31817224, 32646440, 32738192, 33128433, 33256375, 33291545, 33547171, 33893236, 34054801, 34095321, 34285924, 34605719, 35119226, 36674807, 37380713, 38054003, 39226901, 39261837, 39388354, 7635520, 7909242, 8626615, 9545531	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17615234, 19609102, 22392608, 28387597	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19843086, 21626027		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34631897	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	11544282	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	11342444, 14592838, 17725802, 18566410, 19176318, 21183795, 24047902, 24894771, 27846610, 29686686, 31191551, 33170215, 34187243, 8642249	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	25010330	Inhibit	★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal frontal lobe epilepsy	Pubtator	23553139	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35654816	Inhibit	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10403931, 15196263, 18685727, 21959269, 22385240, 23527071, 24574333, 24887071, 25410656, 27922688, 30971748, 32756992, 33142293, 35941595, 36226612, 37093132, 39838177, 8814751, 9067527	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26841832, 31614573	Inhibit	★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	11050177, 12438445, 12449171, 18250483, 19454729, 20299529, 24719461, 24995984	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10539886	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	37883426	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	35413272	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911, 17631149, 34918678	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	32878426	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31767892	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	36676744	Associate	★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	24379648	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	15320912	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33974229	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	29098565	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	37809066	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	29472917	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	15345281, 29415975	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24833097	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	14691297, 15196256, 25917097, 29168181, 30305453, 37106402	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	37848421	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	30568305	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	34244562	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	28774302	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32974852, 37261085, 38267913	Associate	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	36380012	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11466395, 12794115, 19596912, 22471961, 22678162, 23034170, 23169287, 23778140, 25605488, 25997452, 27117582, 27707838, 27727484, 30069490, 30221739, 30670769, 31408436, 31790361, 32222891, 32562536, 32810665, 33103515, 33145341, 33623115, 33767579, 33785258, 34386013, 34518441, 34531868, 34620015, 35373393, 35486183, 35603183, 35639264, 35819135, 36189580, 36207751, 36281185, 36376974, 36437379, 36528658, 37596527, 37940345, 38170155, 38181289, 38263363, 38266804, 39175074, 39218304, 39391306, 40142285, 7929817	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34365471	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	28054583, 9828857	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	24116927, 28257632, 31901157, 36561744	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	25797206, 37507442	Associate	★☆☆☆☆ Found in Text Mining only
Brucellosis	Brucellosis	Pubtator	20404074	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	11877289, 22289994, 34489944	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12133989, 17521425, 20876453, 22162713, 24628049, 34668039, 7595225, 8695856	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	34668039	Inhibit	★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	28241036	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	14770079	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	9400611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24519063, 33941222, 36864443	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	22382400	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27117439, 33623115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22471961, 35776197	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14716821, 15633209, 17372588, 17457217, 18793383, 20087354, 20686664, 20883314, 21419713, 22505239, 23223899, 23526963, 25907075, 26517519, 27136203, 29670256, 30116751, 31485637, 31903159, 32075608, 32170378, 32218692, 32626741, 32863381, 32945410, 33264420, 33426064, 33441885, 34221187, 34405225, 34424809, 34531868, 34769191, 34813686, 34980144, 35092558, 35123420, 35189839, 35321724, 35363194, 35833147, 35986302, 36211805, 36221095, 36536232, 36746728, 36938729, 37077908, 37089050, 37335078, 37371463, 37400463, 37881434, 39289669, 39738479, 39838375, 40410708, 7927492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15180734	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	40010639	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26249178, 32203210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	36263183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19673890, 21829534, 22454499, 30485902, 31221207, 33914317, 35449092	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24746181, 24797069, 25827621, 28898495, 33777046, 35655709, 35836806, 35987606, 36512410, 40410886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10431690, 10944605, 12208877, 18004564, 19001137, 19238009, 19454729, 19609102, 1968360, 21300979, 25563193, 25824786, 30534127, 31431691, 32469992, 33322496, 33429832, 33619294, 34290908, 34402193, 34531868, 34795663, 36463235, 36611966, 36712923, 36793506, 38292868, 39348357, 9328129	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32277125	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33177244	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12716470, 19596931, 21200385, 22402444, 25340823, 31881010, 34531868, 35195152, 35799269, 36703911, 36966704, 37164914, 37177979, 37415224, 9119748	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19220831, 20473949	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	19623656	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	34876047	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	22774985, 28543170	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19397801, 27974462, 28207945, 37967839	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	34489963	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30157919, 31275310, 32229536, 35292700, 37166484, 40649979	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34360781	Stimulate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	37151356	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33480285, 36304068, 37644056	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27241313	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	37175521	Associate	★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	Pubtator	17665008	Inhibit	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	24785834	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	10784586, 12324465, 17307878, 19351412, 22785229, 23326425, 23571506, 23874626, 23878218, 24968232, 26838051, 28049849, 28166225, 28283419, 29191561, 31457091, 31628754, 3261663, 33057065, 33654213, 33927210, 33927715, 34495570, 34618841, 34895167, 34960101, 35119226, 35371081, 35995787, 38415552	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19096978		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	25465638	Inhibit	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	23409198, 24282598, 2783859	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27884769, 32344922, 35962388	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37459093	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	17635814, 29160519, 29473686	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	22774985, 28543170, 29160519	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39359389, 40410708	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	24726754, 28597951, 37256725, 38199298	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	33095470	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	26104913	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19394279, 22647666, 23012327, 23508476, 24136005, 24935928, 30700717, 37863732	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	1834575	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	18451325		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	25139022	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19220836, 39657893	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37373554	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	11298351, 20465565, 35707543, 39210005	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	23695510, 9743220	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12699425, 1889695, 19292766, 19318319, 25144293, 25386078, 25526204, 26333292, 26345973, 26522261, 26589955, 28453768, 29512372, 31191543, 31206576, 31330513, 31356607, 32210709, 32908909, 33907256, 35876170, 36746519, 37055495, 37273534, 37788725, 39586377	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17602351, 9743220	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9071939, 9329971, 9824577	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	7797233		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22319577, 30013992, 35445138, 37370088, 37626132, 37770581	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10602890, 12695859, 14612896, 14968119, 17122624, 17510400, 21179245, 22276195, 22408358, 2365056, 23955802, 24064667, 24833093, 25268580, 25445815, 27110571, 27619682, 27682874, 28210081, 29020986, 29992127, 30013992, 31351430, 31354723, 31488881, 31921188, 32571262, 33101776, 33229508, 33413474, 33818637, 33868236, 34357372, 34717544, 34938284, 35127345, 35262923, 35292828, 35321516, 36063748, 36633318, 37483596, 37800782, 38364976, 38415552, 38583239, 39508845, 40001057, 40069612, 40274385, 40312697	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33625532	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	29710228	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10403927, 11876763, 14616794, 16412063, 17223965, 17302902, 19162554, 23039891, 23432692, 25225461, 25295286, 25926555, 26684629, 28054583, 29083052, 31445098, 32174910, 32575504, 3289139, 33193371, 34247288, 35305035, 38129593, 8666443, 9367399	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	12165093, 1638763, 24130688, 29345621, 37086677, 8100719	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	10331508, 17919564, 24419807	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11882051	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18832677, 21889313, 22645426, 25001165, 35776197, 36077273, 36865544, 40508061	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18832677, 35478415, 36060667	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	24167372	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	37325628	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	27383318	Inhibit	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	34719421	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	12174361	Inhibit	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	36091021	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33041191	Inhibit	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	37965255	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11709514, 12699425, 15020649, 15306587, 15306590, 16045746, 19289577, 19318319, 20298123, 2101599, 22128034, 22167015, 23232296, 24681654, 24935928, 25761185, 27267052, 29453928, 29489879, 31158273, 31191543, 31968593, 33298614, 33313682, 35760777, 36746519, 37280154, 37550393, 37586415, 37752523, 38090774, 38211712, 9060820, 9071939, 9329971, 9422543	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23695510	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	9743220	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	10504398	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24911279, 25803862	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	34399738, 35589692, 40435311	Associate	★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Dacryocystitis	Pubtator	27358392	Associate	★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Adenosine deaminase 2 deficiency	Pubtator	36248833	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	15890908	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	24829360		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	15361220, 23110234	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	18276105	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	33112414, 37086677, 37327287	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	12060402, 19657353, 31148973	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11069080, 11511293, 11720173, 16354184, 16484990, 16782037, 1714926, 18007580, 19439349, 22686584, 22968402, 26288354, 27448748, 29703987, 31511620, 33093567, 33807704, 35576187, 35743308, 37330465	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	31205958	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	39196303	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	12653839, 21197090	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	15829578, 19953283, 24441329, 29172719, 29494763, 30157932, 33413573, 33675790, 35711463, 35762881, 35799782	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19949654	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36203592	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36513052	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17526997	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31995625, 35154512, 35727147, 36077273, 36600150, 36865544, 37773841, 38408622, 8700877	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15030582, 15182254, 15358643, 15667574, 16030184, 16260488, 1696864, 17032246, 17206281, 18248531, 18803760, 19037920, 19180473, 19654878, 19875613, 20045101, 20498357, 21896932, 22332874, 23390544, 24239002, 24348676, 24376757, 24523574, 24968232, 24973447, 25421756, 25523632, 25652388, 25682896, 26518356, 26631741, 26714416, 26888215, 27181214, 27629486, 28024918, 28248954, 28566371, 28645874, 29176645, 29229565, 29791073, 30619245, 30650147, 30723474, 31110501, 31511930, 32060144, 32248243, 32878069, 34127860, 35007320, 35022272, 35142878, 35626661, 36169248, 36201618, 36477008, 37040399, 37309552, 37432736, 37751304, 8082309, 9294207	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	17100770, 23915345, 3280182	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24677179, 31299986	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17526997, 27459386, 29107298, 29752628, 30044774, 30270447, 36940958, 36945068, 40080435	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25363329, 30574794	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30652669	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15182254, 19843086		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	7554346		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	11369787, 27606804	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34506229	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	39290701	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	40214234	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	22873400, 35398299, 35586668	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	9030883	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	19040613, 21323691, 31297990, 31322747, 37006241	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	20141355, 30949166	Inhibit	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	23037630	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22861363, 31699819	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	35222360	Inhibit	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	32183889, 33855355	Associate	★☆☆☆☆ Found in Text Mining only
Duchenne and Becker Muscular Dystrophy	Duchenne And Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	12738386, 15618192	Associate	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	30171206, 33707430	Associate	★☆☆☆☆ Found in Text Mining only
Dysentery	Dysentery	Pubtator	28854225	Associate	★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	Pubtator	19949654, 26045819	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	32452087	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	21079332	Stimulate	★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	32416752	Stimulate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema	Pubtator	35479072	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	22092655, 24116927	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	24805101, 30335480, 33936110	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	17060473, 31332390, 32109548, 32744608	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25931171, 28300844, 32066405, 32339157, 35693634, 36207751, 36581331, 36881401	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25275597, 30325236, 31615517, 31941945, 37081668	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	22267598	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31801814	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11591792		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	16219537, 17166416, 32849632, 8642249	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37699081	Associate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	35202881	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Generalized	Generalized epilepsy	Pubtator	40495522	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	32744608	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23082063, 27577071, 38065897, 40587482	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23889244, 28949934, 32317292, 34616847	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	36891527	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	20646339	Associate	★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency acquired	Factor viii deficiency	Pubtator	12911593	Associate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	15544632	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33478117, 36555549, 36899621	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	28557197	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	21619669, 27001659	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	23514202, 26032326, 26370228, 39394558	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	29867995	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26806136	Associate	★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	15322179	Stimulate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	23891730	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34185421	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27306341, 32974219, 34589088, 38366919, 9784570	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	12942579, 26516200	Associate	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	31145102	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11328295, 12548603, 15054822, 15832009, 33526873, 35523765	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	10389595, 15916690	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	27855396	Inhibit	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	14672892, 22147555, 30037347, 31379838, 34583923, 35003111, 37435729, 37952293, 39436725, 40095634, 8113687	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	33095470	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	34234776	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16723631, 1848799, 18490770, 19028999, 22937035, 24570975, 25555571, 26578623, 28412740, 28880903, 30299157, 30568305, 31451090, 33449451, 34531868, 35599254, 35969754, 35994815, 38057698, 39513882	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17066899, 17216339, 1836455, 18577234, 24375192, 24691423, 26578623, 28620836, 31690954, 33140187, 34531868, 35720326, 35812432, 36325335, 36714574	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	34876047	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	20506525	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	1982451, 20484297	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32085673, 34823491, 35351150, 35528619, 37752523, 7908616, 7996808	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	36059518	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	15954921, 37974210	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	33059348	Associate	★☆☆☆☆ Found in Text Mining only
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to	Hereditary hemolytic anemia	Pubtator	8288627	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease 0 Muscle	Glycogen storage disease	Pubtator	10539886	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	28389590	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33267869	Inhibit	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	9472657	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	34289887	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	36550178	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10516610, 12946996, 15284108, 15327522, 15459005, 16038781, 16443514, 16681643, 19505389, 20302964, 21835147, 25300871, 25543092, 26327693, 27812545, 28746369, 30894856, 31205958, 33133081, 34657151, 35015822, 36056390, 36071219, 7670118, 8063938	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12780786, 16792671, 33226726	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19912254, 23226545, 24859877	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	15972448		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11562512, 11678911, 12000723, 12716450, 14764530, 15147365, 16837919, 16918819, 20113371, 21484763, 22490506, 28615072, 35039330, 37086441, 9764612	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	28040323, 36613701	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	8881751	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	10780664, 15147360, 19240157, 22216337, 24478186, 25940130, 29259988, 2962792, 30938833, 31554206, 33980771, 34616359, 35220890, 35720300, 39388354, 7900942, 8025214, 9545531, 9546811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23249428, 27206624	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	30956992, 33987447, 40155866	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	10781517, 15148216, 27349268, 28485799, 29974826, 32176314, 38536014, 39234250, 39689341	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19419934	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37875358	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	21147625, 23249428, 27206624	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	24478186, 25940130, 39508448	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35720300, 7994911	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	15714205		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20857101, 28945296, 7790320	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	39281206	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17635814, 18617642, 22574131, 29160519, 29473686, 30379878, 38116006	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18037740, 20462651, 25984539, 34857156, 36555549, 37390254	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21935395	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28838148	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	23417848, 28143491	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12483012, 29122757, 36341566, 40028321	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	15086421	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	15730400	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19406979	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	18034765, 29444872, 36936969	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	10354153	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36855107	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	28751644, 36293192	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	31494259	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28597951, 29358858, 30600293, 31422415, 36159854, 36841352, 37290592	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23032418, 24672661, 25786446, 26173605, 28591184, 34177894, 35458518, 36635631	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28231294	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	15996036, 22978653, 28606013	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	28231294	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15865084, 17034579, 17601623, 20710056, 24465502, 24489961, 24760894, 29120899, 31952232, 32750098, 33912168, 34930041, 36405960, 9227171	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22671952, 23555014	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27183178, 34474121	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24130824, 32994477, 33912168	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	26684629	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30206415, 33367520	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12116341, 16757686, 17158640, 17644739, 18362907, 18502823, 26084540, 2675617, 27312067, 2965930, 29880615, 32589698, 34506624, 34615710, 35111387, 37933048, 7518195, 7573367	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18956470	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	34584203	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	34802797	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	10886202, 11298328, 11559946, 16219537, 19608752, 23642304, 25398061, 25682606, 32849632, 39788434, 8608231, 8642249	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	17526997	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25894202	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	30983877	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	27902892	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24116927, 29105795, 9824577	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	11511310, 37074725	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1373352	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	27764137	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27765883, 29388859, 33196557, 35586668	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	34930041	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	20973920, 31141166, 37731513	Associate	★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets Autosomal Dominant	Hypophosphatemic rickets	Pubtator	9389727	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	40155866	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	Pubtator	16489183	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10539886, 10880747, 34194423	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24931519	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10337028	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20126467, 22037258, 23262513, 28754682, 31694639, 32320626, 33386384, 36871016, 37266442, 37544465, 39205185, 39289672, 39510135	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	12942579, 1373086, 1683740, 19923460, 21257970, 22837194, 23152910, 28940416, 31545490, 33193371, 34938286, 35618845, 35935994	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	20196868, 30996137, 31398453, 36380676	Inhibit	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	1698680		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36603467	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11298349, 15020649, 18330941, 18422560, 21147109, 21376048, 22158873, 22965858, 25978359, 28164626, 29547621, 31417161, 32016358, 32547537, 32598439, 34108969, 34224909, 34673799, 36167345, 36437465, 36746519, 37063924, 37124046, 37600767, 37752523, 39343250, 39586377, 9422543	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27001939	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34858418, 36193061	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22228968	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	28854225	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	36825028	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35833148	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	37648784	Associate	★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Herpetic keratitis	Pubtator	11069987	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20977632, 26603521, 27413076, 31535918, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	11737371, 24189710, 25484131, 27460884, 27957330, 28858434	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31855296, 34030645, 37657842	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27180957	Stimulate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	26839444, 28396876	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	27357431	Inhibit	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	25139022	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	25139022, 33793565	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	25200768, 35106507, 38416647	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	16339528, 18424702, 22002092, 22205964, 23936569, 24214631, 25672298, 7524076	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19618084	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	24214631, 24454972, 30642265	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10458772, 10845931, 12393705, 15070688, 15295005, 15845894, 15958635, 16569594, 16585953, 18227839, 18316730, 20113470, 2070082, 20820776, 21205081, 21310823, 2195543, 22647666, 22753942, 2296082, 24741612, 25629163, 25815345, 26474588, 2783859, 2846089, 29805109, 30619360, 32812702, 35210405, 35255120, 35820057, 36010641, 36179686, 8611704, 8652829, 8896419, 8995603, 9485189, 9716596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20801903	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	20687201, 23347903, 7911341	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15958635, 17005036, 19903675, 28807569	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12010820, 12483012, 15388576, 22592607, 22879624, 24741612, 24757092, 24961348, 25400771, 27821506, 2783859, 29843224, 29908544, 29922294, 32456622, 33054115, 33957373, 34011073, 34555853, 34845035, 34913594, 35820057, 35924580, 36081495, 36477735, 36960073, 37288810, 37759316, 7579404, 9002966, 9920842	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	8095167	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	34465597	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	23840511, 30740944	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	20638239, 21735469, 23681290, 24116927, 25042122, 25627620, 27631617, 28425483, 30600293, 35309298, 7851017, 9545531	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	15634930, 25953611, 29281718, 33386815	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36635631, 37327339	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	16937439, 29229400	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	21605420	Inhibit	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	30644704	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15730402, 18241227, 24116927, 34867961, 35364330, 7586671	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	40190436	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	12827664, 16287509, 22288596, 27145754, 29172719, 32162841, 33298584, 33413573, 35250976, 37535195, 37898737	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11970966, 16585607, 18064389, 20565977, 21681373, 24244422, 24761885, 25325779, 27692344, 28253320, 31043415, 31066485, 33859531, 34048945, 34137173, 36219677, 37580655, 38007577, 40157887	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28187172	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	17530636, 32082077	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	35979531	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10430616, 10508246, 11315925, 11352243, 12568118, 14872508, 15004168, 15147571, 15476242, 15498047, 15547095, 16606650, 16802356, 16879242, 17277168, 17665008, 17947713, 18194272, 18311820, 18451510, 18505426, 18505436, 18576316, 18641361, 18668553, 18800986, 19155519, 19289577, 19520616, 19815495, 19841178, 19843090, 20131288, 20506525, 20589076, 20625494, 21110900, 21192791, 21436623, 21538319, 21708033, 21959034, 22235999, 22549474, 22549634, 22621248, 22835828, 23019580, 23434382, 23623029, 23913957, 23915345, 23950730, 23962407, 24047902, 24082908, 24391825, 24463447, 24495300, 24500400, 25070893, 25454068, 26005050, 26055806, 26079624, 26209442, 26453305, 26582197, 26764034, 27065298, 27111767, 27156107, 27424138, 27600584, 27737517, 27852285, 27915349, 28430662, 28793932, 28973837, 29018507, 29066026, 30009168, 30315781, 30662367, 30962246, 31331400, 31354747, 31412880, 31431691, 31514450, 31536480, 31653682, 31781109, 31808546, 31848026, 33007439, 33176801, 33329581, 33562078, 33670902, 33882880, 34079550, 34149710, 34256772, 34890161, 34899718, 34940981, 35172900, 35762881, 35940821, 36075396, 36180106, 36314527, 36351407, 36499016, 36536372, 36703979, 36748375, 36781170, 36815949, 37072752, 37114204, 37179450, 37400575, 37586763, 38078808, 39333474, 39375179, 39388354, 7531628, 8403494, 9716112	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	14871297, 16423064, 19173720, 26076826, 30988119, 32718891, 35130317, 8100746, 8918566	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20334681, 24774748, 32317002, 33475152	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17712998, 19004052		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	12568118, 16879242, 19021013, 20213807, 21635228, 24475019, 24774748, 27156107, 31331400, 31536480, 31685786, 33277543, 34081342, 36430418	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23826668, 24870595, 36980192, 37270478, 38263363	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	37108757	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	27925643, 37401643	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10803703, 12095642, 14592815, 16410445, 17388670, 17615291, 17891925, 18227839, 19443664, 20176801, 21274672, 21904560, 22647666, 23025755, 25628470, 26464657, 27193732, 27980301, 28885361, 2943330, 30237271, 3120822, 33202420, 35895386, 7678256	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10540330, 18814264, 21270444, 22015774, 23775959, 25700246, 29293620, 30784598, 33133070, 34267181, 35030632, 35687817, 39248131	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	23368872	Associate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	31781092		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10864684, 11509608, 12437636, 15691277, 29517683, 31558678, 33965183, 35523507	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28377586, 29132135, 39547643	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35352887	Stimulate	★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	17362263	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16758122		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	22479353	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	32174910, 36759849	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10049939, 10049951, 10330445, 10618430, 10684854, 11259659, 11742496, 12794170, 14770079, 15085202, 16799335, 1712819, 18343923, 18414854, 18606658, 18941742, 19435913, 19581576, 19651643, 19779716, 20547105, 20696919, 21397857, 21690475, 21903207, 22371843, 22400038, 22454499, 23935194, 24396833, 24756419, 26245876, 26608910, 26641258, 27094152, 28640942, 29360643, 29895674, 30123214, 31275310, 31630873, 32210968, 32246006, 33031392, 33785258, 33820810, 34220837, 35189004, 35383113, 35508657, 37418389, 37466381, 37466668, 37505479, 39210005, 40226614, 7923247, 8101473, 9182821	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29546435, 37170241	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34047683, 34531868	Associate	★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	Melas syndrome	Pubtator	38499449	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25400783, 40441235	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25609200	Inhibit	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	30245692	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36865544	Associate	★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11739707, 30320604, 31707363, 36462403	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	18276105	Inhibit	★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	24829360		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	11439170	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12412747, 25275597, 28193831, 32063460, 33007050	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36086675	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	28754092, 29168181, 32744608	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	31532776	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	12653853, 18070150, 22645426, 33188570, 33622252, 35222381, 35755167, 35924269, 7851022, 9486410, 9790317	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	38357816	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	33514545	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	22156200, 29511683, 34589088	Associate	★☆☆☆☆ Found in Text Mining only
Mulibrey Nanism	Mulibrey nanism	Pubtator	33042106	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14717778, 15578069, 16150935, 16410445, 18071334, 18156498, 1832993, 20568250, 20651070, 21030562, 21904560, 22666318, 23152910, 23232072, 25099367, 29511683, 33488620, 34502204, 35222688, 36105747, 36982802, 37815499, 38574299, 39175948, 8605346, 9504626, 9504628	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15750834, 33013907	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10193428, 10736102, 11602626, 15048733, 16547138, 17897326, 18156204, 18378324, 18727631, 18769633, 19016907, 19740340, 19740385, 20065129, 20148420, 20174631, 20661655, 21067621, 21079332, 21281812, 21300823, 21427490, 21653833, 21810280, 22182694, 22768094, 22837658, 23039885, 23202893, 23638056, 24282598, 24376757, 24453076, 24659064, 24852325, 25738751, 25938517, 26203907, 26829210, 26849221, 27162345, 27424664, 27438997, 27570566, 27626663, 28155899, 28301515, 28729889, 29168181, 29290406, 30173916, 30305453, 30379917, 30698680, 30759186, 30848579, 31024521, 31427643, 31566584, 31581595, 31968593, 32328067, 32375811, 32518073, 32817525, 33037101, 33091337, 33112414, 33158438, 33222687, 33354282, 33529846, 34006899, 34251726, 34285924, 34561436, 34643957, 34873174, 35266286, 35479072, 35672799, 35693770, 35868128, 36341423, 37106402, 37506490, 37824079, 38009648, 8197142, 8901604, 9119974	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17020785		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18156204		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	29295981	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	30770703	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	20382434	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	10525041, 11785677, 14575152, 15049785, 15454488, 16585608, 17323412, 23110942, 26347149, 32243615, 33136553, 35265719, 35979348, 38325197, 40525756, 8094093, 8827715, 9737677, 9867130	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	10504456, 1828937, 1987296, 19935642, 21148332, 22722467, 25044837, 25158034, 2527911, 28206666, 28441377, 30770361, 35406628, 35642346, 36428999	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	38013542	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12358908, 12404285, 20647647, 21097671, 23453286, 33570632, 34631897	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27036031, 31705171	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	30816121	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11966768	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19394279, 19843577, 22426168, 23330016, 24453425, 26375412, 28260995, 34857156, 37798364, 40685440	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	28018858, 37382257	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	27936488, 35371068, 39946176, 9008283	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	24594700, 35131904	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26095067, 33287713	Inhibit	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34830017, 35727147	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	17665008, 27821550, 33837283	Associate	★☆☆☆☆ Found in Text Mining only
Narcolepsy 1	Narcolepsy	Pubtator	28107375, 31048269, 37380713	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19250527, 20515572, 25269704, 26239551, 27468819, 36466903	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19639723	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	14694109, 17262084, 18297191, 19220831, 22226739, 31574860	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11967324, 18596085	Associate	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	36384506	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	21762125, 26123900, 28963877	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	1803038	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	26329520	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1958129		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31141166, 32514618, 33252831, 33338852, 33968044, 34569303, 36923280, 8794385	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25197660	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28475007	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	10583274, 19344427, 31866622	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22044858, 22228716	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29956501, 33123595, 34231954, 34576307, 34721414, 34850389, 35111163, 36194662, 36945068, 37063877, 37878496, 38207130, 39765379, 39868576	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	37266430	Associate	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	25350973	Stimulate	★☆☆☆☆ Found in Text Mining only
OKT4 EPITOPE DEFICIENCY	Epitope Deficiency	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	21958417	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10419780, 15731292, 20430731, 24742142, 27044824, 28112376, 29283192, 33482899, 34397812, 38401067, 39738612	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31205958	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	37731506	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	29283192	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	34426754	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	19214244	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	32954739	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24519063, 28671022, 37150900, 40374042	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37993664	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19673890, 21829534, 22083345, 23354626, 23526963, 24244610, 24764581, 31064389, 31537619, 33381581, 33414414, 35940161, 36545327, 36604635, 36837407, 37063862, 37317670, 37446361, 37950246, 7648722, 8407555	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16947023, 19798410, 25827621, 31068935, 31796877, 34531868, 35012444, 36029726, 36509285, 37861515, 37881431	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37455016	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18376303		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28705256, 30894427	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	24797069, 34702715	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	19861144, 22322668, 28060843, 38193541	Associate	★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	33178221	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15864345, 15864353, 17409595, 17483473, 18190256, 18326816, 18664281, 19740339, 21208912, 22335964, 22647666, 23405908, 23409198, 24041428, 24845974, 24960164, 26358743, 31340370, 33837058, 39339919, 40004169	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	8052162	Stimulate	★☆☆☆☆ Found in Text Mining only
Paresthesia	Paresthesia	Pubtator	19740340	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19505389, 20813038, 23054369, 27230441, 32884248, 33272323, 33386815, 33514545, 34289265, 35279225, 36224715, 36499121, 36591658, 37454237, 39769168	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24933638	Inhibit	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	21912648	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	37266648	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	15320912, 29335495	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	22310732	Inhibit	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	18373702, 24813052, 33741391, 36203615	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	12067311, 22066676, 7685315	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	10632663, 26732676, 27334899, 30944162, 37063877, 8608641	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33109155	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	40761788	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	36671424	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	33269456	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	12942579	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	16703796, 34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34531868	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30988342, 34847942, 37226082, 38189053, 39754246	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35025147	Associate	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	14672892	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	17195241, 19953283, 30157932	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	24829360		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	22157983, 34606081	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	29105795	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12077288, 18519750, 22647697, 25119597, 28681697, 29105795, 31355524, 32923127, 33785258, 33837451, 33985534, 34806485, 35764368, 36499557, 36686485, 36759726, 37857190, 38062230, 40121536, 9627224	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	24774748	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	35523507	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20943046, 22291603, 23750651, 24286492, 25568543, 29280140, 30747724, 34108969, 7653183	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34233597, 35960497, 36248192, 36555549, 37753829, 39769220	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16246539, 18684844, 19220836, 19378224, 19604272, 19729666, 21651772, 22183488, 23374856, 24805101, 25315895, 25375131, 27549738, 27613775, 27793198, 28053515, 29179729, 30842769, 30988604, 31141166, 31440043, 33223825, 33317530, 33435988, 34426754, 35096207, 35740993, 35991707, 36127695, 37286295, 39346628, 40234829	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17050556, 28934595	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25137293, 29206476, 33651771, 34435653	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	25010330	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	18250483, 25536276, 37731513, 7905208	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	40234829	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	17362263	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	36499121	Associate	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	28143491	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	19004052		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	30537802	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17156343, 17349011, 18797179, 21919915, 24514067, 30537802, 33224143, 36149748, 36713372	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	12653839	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	21975176, 22670772, 22701743, 24062574, 24391521, 24834772, 35942560	Associate	★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow syndrome	Pubtator	9321759	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	34668039	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	34668039	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	10092696, 10908151, 11091281, 11923555, 14508706, 17975675, 18279440, 19480659, 19536643, 21177920, 21959269, 22469005, 22537923, 23630356, 23863960, 24681356, 25004830, 25073001, 26415669, 2669224, 27230441, 27575817, 28827283, 30585624, 32063460, 32508528, 33363531, 35761164, 36613701, 37520566, 37863732, 38097354, 7586698, 7910965, 8529107, 8881751, 9311498	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	24882950, 8143813	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	30452447, 8137547, 9176534	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	11359967, 23630356, 26585430, 29055517, 29234685, 34753769	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36005179	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	37192046	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34440851	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11165927, 22045987, 22787430, 29746555, 33799006, 7521102	Associate	★☆☆☆☆ Found in Text Mining only
Sarcosinemia	Sarcosinemia	Pubtator	28387599	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	27244229, 37552420	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	38066312	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	7726211		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15730402, 19536281, 20973920, 2138008, 21996293, 27145754, 29248544, 31767698, 32977850, 33307312, 35183246, 35663995, 8484693	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31848026	Stimulate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23639073, 38057734	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27459386, 30327490, 30470767, 31484735, 35720398	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34898369, 36250055	Stimulate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	40190436	Inhibit	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	11110711, 1320968, 27301863, 7905018, 8287598, 8920891, 9446656, 9664084	Associate	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	18218852, 9420304	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	11168816, 11348462, 11442758, 12200382, 12437636, 1381718, 15009733, 15245439, 15315967, 1562047, 16418328, 17713571, 18314443, 19211505, 1987293, 19935642, 20663947, 20713771, 20801618, 21085192, 21191411, 23792457, 25806852, 26930587, 27732942, 27766406, 27889686, 28441377, 32760603, 35533722, 7777538, 9717967	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	17522341		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	10403921	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30718403		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10446867, 1720300, 18684981, 23738744, 24117612, 24574234, 26436101, 27346388, 27461134, 28494936, 28621822, 28743286, 29453859, 30336792, 30589451, 30632148, 33050949, 33179091, 33603736, 33883324, 33936039, 34095321, 35944186, 36171070, 37569326, 39480501, 40257948, 40650157, 7683586	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	32963045, 34641948, 36505431	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	7578884, 8082485	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10504451, 10886244, 11511293, 12750155, 1673877, 16782037, 22992805, 23566249, 24286492, 24335103, 34220814	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	12576313	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19581829	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18004564, 32020764, 33674986, 34006632, 35834843	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	19740340	Associate	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic neoplasms	Pubtator	23037630	Associate	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic neoplasms	Pubtator	35610016	Inhibit	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	11207664, 12932293, 15498047, 16180249, 16277694, 20722024, 21248258, 26841353, 27901054, 29960293, 34108969	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25142923	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17252589, 17975141		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12716470, 17235436, 18221909, 18547033, 18559587, 19825957, 20857101, 21442435, 22252752, 22252753, 23826668, 23977174, 24761979, 25153698, 26313665, 26740106, 28574843, 28947422, 29416107, 31662531, 31924475, 32441311, 32719094, 33010009, 33053760, 33125511, 33173143, 33307825, 33390791, 33457076, 33462898, 33513276, 33529452, 33995377, 34373557, 34531868, 34626165, 35039463, 36319566, 36425786, 36512410, 36627705, 36864443, 36930079, 37270478, 37459093, 37828063, 37898859, 38077321, 38129784, 7961115	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32383556	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	27306341	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12942579, 14568977, 20819431, 21528082, 23365642, 2522349, 25260881, 26464703, 27323782, 28488547, 30988066, 31631566, 32028262, 32129682, 32987562, 33312758, 33426088, 33492335, 33837660, 33843442, 34746312, 34868341, 34968167, 35382776, 36249422, 36737759, 37342362, 37359529, 37366273, 37467193, 37499395, 37781029, 38042786, 38090588, 38259671, 38368775, 39299554, 39328412, 39781526	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15618192, 37153541	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37904396	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24650222, 29697202, 33205448	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	17907166, 9260157	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22885552		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	23772771	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	34531868	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	16030183, 28555838, 32744608	Associate	★☆☆☆☆ Found in Text Mining only
Tetany	Tetany	Pubtator	19903780, 21690475	Stimulate	★☆☆☆☆ Found in Text Mining only
Tetany	Tetany	Pubtator	25617427, 26271191	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	40190436	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36319978	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34465342, 34790166	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	1375873, 27045886, 34539667	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	32323619	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	14971052, 15147360, 16698664, 19040601, 27855396, 32045626, 34144109, 37501789, 40155866	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18637101	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	23249428, 27206624	Inhibit	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	28877231, 30728285, 34045665	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26709833	Associate	★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	Pubtator	12121441	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27727484, 30221739, 30305342, 32529292, 32971948, 33301062, 34789319, 35705026, 35797509, 36412444, 37090736, 37199043, 37810779, 38308298, 39643914	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38170155	Stimulate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	26496037	Stimulate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	26709833	Associate	★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Ureteral neoplasms	Pubtator	29243545	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19692168, 26862849, 26927070, 29478100, 30075815, 32228629, 32497499, 34531868, 35669725, 35958598, 36162993, 37313656, 37632832	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Neoplasms	Urogenital neoplasm	Pubtator	33262136	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12121440, 33007050	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10364287, 10864677, 17615234, 19386711, 22094905, 26486970, 31562978, 32306508, 32518078, 33605553, 37344577, 38084896, 9621091	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17937675, 23587428	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33694292	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	36552753	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19557412, 26712692, 32496920, 34531868	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	14977779, 15196263, 23527071, 32479651	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	23818738	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	15043537	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	10361227	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	7882564	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	21297967, 28761327	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15171817, 26603521, 28972094, 33196557, 35883458, 8669478	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	17919564, 20430391, 25484131	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	19381293, 21484763, 28916770, 30510966, 34950150, 37952293, 9808568	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	35883458	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	25001165	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	34764490	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	18548110, 34107850, 37731844, 7871844	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19843086		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33200798	Inhibit	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19843086		★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar lichen sclerosus	Pubtator	33438816	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30981637, 34597382	Associate	★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Winter shortland temple syndrome	Pubtator	29367348	Associate	★☆☆☆☆ Found in Text Mining only