SLC16A7 (solute carrier family 16 member 7)

Gene

• Entrez ID: 9194
• Gene name: Solute carrier family 16 member 7
• Gene symbol: SLC16A7
• Synonyms (NCBI Gene): MCT2
• Chromosome: 12
• Chromosome location: 12q14.1
• Summary: This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024296	hsa-miR-215-5p	Microarray	19074876
MIRT026289	hsa-miR-192-5p	Microarray	19074876
MIRT467931	hsa-miR-4464	PAR-CLIP	23592263
MIRT467930	hsa-miR-4748	PAR-CLIP	23592263
MIRT467929	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT467928	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT467927	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT467926	hsa-miR-759	PAR-CLIP	23592263
MIRT467925	hsa-miR-4729	PAR-CLIP	23592263
MIRT467924	hsa-miR-20a-3p	PAR-CLIP	23592263
MIRT467923	hsa-miR-496	PAR-CLIP	23592263
MIRT467922	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT467931	hsa-miR-4464	PAR-CLIP	23592263
MIRT467930	hsa-miR-4748	PAR-CLIP	23592263
MIRT467929	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT467928	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT467927	hsa-miR-506-5p	PAR-CLIP	23592263
MIRT467926	hsa-miR-759	PAR-CLIP	23592263
MIRT467925	hsa-miR-4729	PAR-CLIP	23592263
MIRT467924	hsa-miR-20a-3p	PAR-CLIP	23592263
MIRT467923	hsa-miR-496	PAR-CLIP	23592263
MIRT467922	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT1353213	hsa-miR-105	CLIP-seq
MIRT1353214	hsa-miR-1297	CLIP-seq
MIRT1353215	hsa-miR-132	CLIP-seq
MIRT1353216	hsa-miR-188-3p	CLIP-seq
MIRT1353217	hsa-miR-1915	CLIP-seq
MIRT1353218	hsa-miR-2053	CLIP-seq
MIRT1353219	hsa-miR-212	CLIP-seq
MIRT1353220	hsa-miR-224	CLIP-seq
MIRT1353221	hsa-miR-26a	CLIP-seq
MIRT1353222	hsa-miR-26b	CLIP-seq
MIRT1353223	hsa-miR-302a	CLIP-seq
MIRT1353224	hsa-miR-302b	CLIP-seq
MIRT1353225	hsa-miR-302c	CLIP-seq
MIRT1353226	hsa-miR-302d	CLIP-seq
MIRT1353227	hsa-miR-302e	CLIP-seq
MIRT1353228	hsa-miR-3145-3p	CLIP-seq
MIRT1353229	hsa-miR-3166	CLIP-seq
MIRT1353230	hsa-miR-331-5p	CLIP-seq
MIRT1353231	hsa-miR-372	CLIP-seq
MIRT1353232	hsa-miR-373	CLIP-seq
MIRT1353233	hsa-miR-409-3p	CLIP-seq
MIRT1353234	hsa-miR-4282	CLIP-seq
MIRT1353235	hsa-miR-4289	CLIP-seq
MIRT1353236	hsa-miR-4446-5p	CLIP-seq
MIRT1353237	hsa-miR-4465	CLIP-seq
MIRT1353238	hsa-miR-4726-3p	CLIP-seq
MIRT1353239	hsa-miR-4733-5p	CLIP-seq
MIRT1353240	hsa-miR-4735-5p	CLIP-seq
MIRT1353241	hsa-miR-4755-5p	CLIP-seq
MIRT1353242	hsa-miR-4769-3p	CLIP-seq
MIRT1353243	hsa-miR-4771	CLIP-seq
MIRT1353244	hsa-miR-4774-5p	CLIP-seq
MIRT1353245	hsa-miR-4799-5p	CLIP-seq
MIRT1353246	hsa-miR-499a-5p	CLIP-seq
MIRT1353247	hsa-miR-512-3p	CLIP-seq
MIRT1353248	hsa-miR-520a-3p	CLIP-seq
MIRT1353249	hsa-miR-520b	CLIP-seq
MIRT1353250	hsa-miR-520c-3p	CLIP-seq
MIRT1353251	hsa-miR-520d-3p	CLIP-seq
MIRT1353252	hsa-miR-520d-5p	CLIP-seq
MIRT1353253	hsa-miR-520e	CLIP-seq
MIRT1353254	hsa-miR-524-5p	CLIP-seq
MIRT1353255	hsa-miR-548c-3p	CLIP-seq
MIRT1353256	hsa-miR-7	CLIP-seq
MIRT1353257	hsa-miR-764	CLIP-seq
MIRT1353258	hsa-miR-944	CLIP-seq
MIRT2104570	hsa-miR-1246	CLIP-seq
MIRT2104571	hsa-miR-3122	CLIP-seq
MIRT2104572	hsa-miR-3607-5p	CLIP-seq
MIRT2104573	hsa-miR-3913-5p	CLIP-seq
MIRT2104574	hsa-miR-450b-3p	CLIP-seq
MIRT2104575	hsa-miR-490-5p	CLIP-seq
MIRT2104576	hsa-miR-769-3p	CLIP-seq
MIRT2623474	hsa-miR-1236	CLIP-seq
MIRT1353217	hsa-miR-1915	CLIP-seq
MIRT2623475	hsa-miR-200b	CLIP-seq
MIRT2623476	hsa-miR-200c	CLIP-seq
MIRT2623477	hsa-miR-3143	CLIP-seq
MIRT2623478	hsa-miR-3612	CLIP-seq
MIRT2623479	hsa-miR-3646	CLIP-seq
MIRT2623480	hsa-miR-3662	CLIP-seq
MIRT2623481	hsa-miR-3675-3p	CLIP-seq
MIRT2623482	hsa-miR-4263	CLIP-seq
MIRT2623483	hsa-miR-429	CLIP-seq
MIRT2623484	hsa-miR-4459	CLIP-seq
MIRT2623485	hsa-miR-4695-5p	CLIP-seq
MIRT2623486	hsa-miR-4698	CLIP-seq
MIRT1353238	hsa-miR-4726-3p	CLIP-seq
MIRT1353239	hsa-miR-4733-5p	CLIP-seq
MIRT1353242	hsa-miR-4769-3p	CLIP-seq
MIRT2623487	hsa-miR-495	CLIP-seq
MIRT2623488	hsa-miR-543	CLIP-seq
MIRT2623489	hsa-miR-548aa	CLIP-seq
MIRT2623490	hsa-miR-576-5p	CLIP-seq
MIRT2623491	hsa-miR-650	CLIP-seq
MIRT2623492	hsa-miR-665	CLIP-seq
MIRT2690902	hsa-miR-136	CLIP-seq
MIRT2623475	hsa-miR-200b	CLIP-seq
MIRT2623476	hsa-miR-200c	CLIP-seq
MIRT2690903	hsa-miR-3117-5p	CLIP-seq
MIRT2104571	hsa-miR-3122	CLIP-seq
MIRT2623477	hsa-miR-3143	CLIP-seq
MIRT2623479	hsa-miR-3646	CLIP-seq
MIRT2623480	hsa-miR-3662	CLIP-seq
MIRT2104573	hsa-miR-3913-5p	CLIP-seq
MIRT2690904	hsa-miR-410	CLIP-seq
MIRT2623482	hsa-miR-4263	CLIP-seq
MIRT2623483	hsa-miR-429	CLIP-seq
MIRT2104574	hsa-miR-450b-3p	CLIP-seq
MIRT2623486	hsa-miR-4698	CLIP-seq
MIRT2690905	hsa-miR-515-5p	CLIP-seq
MIRT2623488	hsa-miR-543	CLIP-seq
MIRT2623489	hsa-miR-548aa	CLIP-seq
MIRT2623490	hsa-miR-576-5p	CLIP-seq
MIRT2104576	hsa-miR-769-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005477	Function	Pyruvate secondary active transmembrane transporter activity	TAS	9786900
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15505343, 32415067
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IEA
GO:0015129	Function	Lactate transmembrane transporter activity	IBA
GO:0015129	Function	Lactate transmembrane transporter activity	IDA	9786900
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IDA	32415067
GO:0015293	Function	Symporter activity	IEA
GO:0015355	Function	Secondary active monocarboxylate transmembrane transporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035873	Process	Lactate transmembrane transport	IMP	9786900
GO:0035879	Process	Plasma membrane lactate transport	IBA
GO:0035879	Process	Plasma membrane lactate transport	IEA
GO:0042802	Function	Identical protein binding	IDA	32415067
GO:0050833	Function	Pyruvate transmembrane transporter activity	IDA	9786900, 32415067
GO:0055085	Process	Transmembrane transport	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417
GO:1901475	Process	Pyruvate transmembrane transport	IDA	9786900, 32415067

Other IDs

• MIM: 603654
• HGNC: 10928
• e!Ensembl: ENSG00000118596

Protein

• UniProt ID: O60669
• Protein name: Monocarboxylate transporter 2 (MCT 2) (Solute carrier family 16 member 7)
• Protein function: Proton-coupled monocarboxylate symporter. Catalyzes the rapid transport across the plasma membrane of monocarboxylates such as L-lactate, pyruvate and ketone bodies, acetoacetate, beta-hydroxybutyrate and acetate (PubMed:32415067, PubMed:9786900
• PDB: 7BP3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	21 → 390	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in heart and in blood lymphocytes and monocytes (at protein level) (PubMed:15505343). High expression in testis, moderate to low in spleen, heart, kidney, pancreas, skeletal muscle, brain and leukocyte (PubMed:9786900). Restri
• Sequence:

  MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
  ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT
  GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI
  LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
  LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
  GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE
  TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW
  LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI

• Sequence length: 478

Pathways

Reactome:

Proton-coupled monocarboxylate transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28644754		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	26587828	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	20885792		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	26031901		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23032108	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23032108		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22700320	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28281525		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21177384, 22700320, 25415228	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9786900	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25206282	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37934721	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25492048, 30521130		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18188595		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18188595, 28874966, 29945573, 30521130	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	BEFREE	31713246		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36340268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27987117		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30022509		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22281667		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28092823		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28092823	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40410718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20454640	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	17416968		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28092823	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	24799634	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35263597	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26434591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28281525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26035357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27224918		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28281525		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28281525		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	21787388	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26384349		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26384349	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25206282	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35659152	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30521130	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26434591, 27224918, 28092823, 30521130		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26434591		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25578492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20882379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligospermia	Oligospermia	BEFREE	24799634		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23963315		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	GWASCAT_DG	30487263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	26035357		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21787388, 25639644, 26035357	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25243493	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	15997097	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27224918		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40410718	Associate	★☆☆☆☆ Found in Text Mining only