Gene Gene information from NCBI Gene database.
Entrez ID 9191
Gene name Death effector domain containing
Gene symbol DEDD
Synonyms (NCBI Gene)
CASP8IP1DEDD1DEDPro1DEFTFLDED-1FLDED1KE05
Chromosome 1
Chromosome location 1q23.3
Summary This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak ap
miRNA miRNA information provided by mirtarbase database.
404
miRTarBase ID miRNA Experiments Reference
MIRT030548 hsa-miR-24-3p Western blot 20138800
MIRT052117 hsa-let-7b-5p CLASH 23622248
MIRT040264 hsa-miR-615-3p CLASH 23622248
MIRT036647 hsa-miR-935 CLASH 23622248
MIRT030548 hsa-miR-24-3p FlowLuciferase reporter assayqRT-PCRWestern blot 28000900
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0003006 Process Developmental process involved in reproduction IEA
GO:0003677 Function DNA binding IBA
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
GO:0003677 Function DNA binding TAS 9774341
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606841 2755 ENSG00000158796
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75618
Protein name Death effector domain-containing protein (DEDPro1) (Death effector domain-containing testicular molecule) (FLDED-1)
Protein function A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01335 DED 26 107 Death effector domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in testis. {ECO:0000269|PubMed:9832420}.
Sequence
MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRR
AVCPDLVDKYLEE
TSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
Sequence length 318
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30175664
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 30655776
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 40596977 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm Bladder Neoplasm BEFREE 28000900
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 30777879
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 28000900
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Hodgkin Disease BEFREE 30655776
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus, Systemic Lupus Erythematosus BEFREE 20532967
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 29953965
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of urinary bladder Urinary bladder cancer BEFREE 28000900
★☆☆☆☆
Found in Text Mining only