Gene Gene information from NCBI Gene database.
Entrez ID 9189
Gene name Zinc finger BED-type containing 1
Gene symbol ZBED1
Synonyms (NCBI Gene)
ALTEDREFTRAMPhDREF
Chromosome X|Y
Chromosome location X;Y
Summary This gene is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. It was earlier identified as a gene with similarity to Ac transposable elements, however, was found not to have transposase activity. Later studies show that this gene pro
miRNA miRNA information provided by mirtarbase database.
471
miRTarBase ID miRNA Experiments Reference
MIRT019734 hsa-miR-375 Microarray 20215506
MIRT029074 hsa-miR-26b-5p Microarray 19088304
MIRT030435 hsa-miR-24-3p Microarray 19748357
MIRT043249 hsa-miR-324-5p CLASH 23622248
MIRT038468 hsa-miR-296-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17220279
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 17220279
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300178 447 ENSG00000214717
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O96006
Protein name E3 SUMO-protein ligase ZBED1 (EC 2.3.2.-) (DNA replication-related element-binding factor) (Putative Ac-like transposable element) (Zinc finger BED domain-containing protein 1) (dREF homolog)
Protein function Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase which sumoylates CHD3/Mi2-alpha, causing its release from DNA (PubMed:27068747). This results in suppression of CHD3/Mi2-alpha transcription repression, increased recruitment of
PDB 2CT5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02892 zf-BED 23 72 BED zinc finger Domain
PF05699 Dimer_Tnp_hAT 571 651 hAT family C-terminal dimerisation region Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed at low levels (PubMed:9887332). Expression is highest in skeletal muscle, heart, spleen and placenta (PubMed:9887332). {ECO:0000269|PubMed:9887332}.
Sequence
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHP
EEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
ASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENA
RSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL
Sequence length 694
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    SUMOylation of chromatin organization proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PROSTATIC NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 17638871, 19701244, 27634876, 30188869
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 23842593, 27980106, 28095711
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 16452231, 28197388
★☆☆☆☆
Found in Text Mining only
Carcinoma, Neuroendocrine Carcinoma BEFREE 25298407
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 27292155
★☆☆☆☆
Found in Text Mining only
Familial lichen amyloidosis Lichen amyloidosis BEFREE 27207648
★☆☆☆☆
Found in Text Mining only
Febrile Convulsions Febrile seizures BEFREE 16417553
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 11289132, 15678150, 15761871, 15870705, 16452231, 16927305, 17638871, 17906287, 18649357, 18668517, 18718531, 19147983, 19351827, 19784068, 19879420
View all (41 more)
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer CTD_human_DG 17199135
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 22761195, 24980820, 29400635, 29450905, 29870225
★☆☆☆☆
Found in Text Mining only