Gene Gene information from NCBI Gene database.
Entrez ID 9187
Gene name Solute carrier family 24 member 1
Gene symbol SLC24A1
Synonyms (NCBI Gene)
CSNB1DHsT17412NCKXNCKX1RODX
Chromosome 15
Chromosome location 15q22.31
Summary This gene encodes a member of the potassium-dependent sodium/calcium exchanger protein family. The encoded protein plays an important role in sodium/calcium exchange in retinal rod and cone photoreceptors by mediating the extrusion of one calcium ion and
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs766780281 ATCT>- Pathogenic Intron variant, genic downstream transcript variant, frameshift variant, coding sequence variant
rs777989874 AT>- Pathogenic Coding sequence variant, frameshift variant, genic upstream transcript variant
rs1410075831 G>T Pathogenic Genic downstream transcript variant, coding sequence variant, downstream transcript variant, stop gained
rs1555403793 TCT>- Pathogenic Inframe deletion, coding sequence variant, genic upstream transcript variant
rs1555407654 A>C Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
106
miRTarBase ID miRNA Experiments Reference
MIRT1354757 hsa-miR-15a CLIP-seq
MIRT1354758 hsa-miR-15b CLIP-seq
MIRT1354759 hsa-miR-16 CLIP-seq
MIRT1354760 hsa-miR-195 CLIP-seq
MIRT1354761 hsa-miR-2116 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0005262 Function Calcium channel activity IBA
GO:0005515 Function Protein binding IPI 17474147
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 26631410
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603617 10975 ENSG00000074621
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60721
Protein name Sodium/potassium/calcium exchanger 1 (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) (Solute carrier family 24 member 1)
Protein function Calcium, potassium:sodium antiporter that transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+) (PubMed:26631410). Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and d
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01699 Na_Ca_ex 458 602 Sodium/calcium exchanger protein Family
PF01699 Na_Ca_ex 936 1087 Sodium/calcium exchanger protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the retina, particularly in the inner segment, outer and inner nuclear layers, and ganglion cell layer. {ECO:0000269|PubMed:20850105}.
Sequence
MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPI
KLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAK
MIPTTTKNNYSPTAAGTERRKEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPT
QVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRI
MEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNNLFPPRRVESNSSAHPWGLVG
KSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSPRTSVSAIKTA
PAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPA
LGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVI
GTCSLFSREILNLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTM
KW
NKHIEVWVKEQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSST
SLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKL
PAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPE
GEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLD
WPETRQKQAIYLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAH
QVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPV
PWLLFSLINGLQPVPVSSNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFV
FLIISVM
LEDRIISCPVSV
Sequence length 1099
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Phototransduction   Sodium/Calcium exchangers
Defective SLC24A1 causes congenital stationary night blindness 1D (CSNB1D)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Colorectal cancer Likely pathogenic rs766014688 RCV005922636
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital stationary night blindness 1D Pathogenic; Likely pathogenic rs201452975, rs766014688, rs762665302, rs767508005, rs1410075831, rs766780281, rs1566945534, rs777989874 RCV002488199
RCV001807971
RCV005631252
RCV000023321
RCV000579382
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital stationary night blindness autosomal dominant 2 Likely pathogenic; Pathogenic rs777989874 RCV004760695
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder Pathogenic rs748399766 RCV005924374
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL STATIONARY NIGHT BLINDNESS GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Congenital Stationary Night Blindness, Recessive Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cone-rod synaptic disorder, congenital nonprogressive Congenital stationary night blindness CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Congenital stationary night blindness Congenital stationary night blindness Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Disorder of eye Disorder Of Eye GENOMICS_ENGLAND_DG
★☆☆☆☆
Found in Text Mining only
Hypoplasia of optic disc Hypoplasia Of Optic Disc HPO_DG
★☆☆☆☆
Found in Text Mining only
Myofibrillar Myopathy Myofibrillar myopathy BEFREE 30289745
★☆☆☆☆
Found in Text Mining only
Night blindness congenital stationary Night blindness, congenital stationary Pubtator 35486108 Associate
★☆☆☆☆
Found in Text Mining only
Night blindness, congenital stationary Night blindness BEFREE 20850105, 26822852
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Night blindness, congenital stationary Night blindness ORPHANET_DG 20850105
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Night blindness, congenital stationary Night blindness HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Night blindness, congenital stationary Night blindness GENOMICS_ENGLAND_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations