Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9184
Gene name	BUB3 mitotic checkpoint protein
Gene symbol	BUB3
Synonyms (NCBI Gene)	BUB3LhBUB3
Chromosome	10
Chromosome location	10q26.13
Summary	This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have

372

Show/Hide all (372)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032111	hsa-let-7d-5p	Sequencing	20371350
MIRT039843	hsa-miR-615-3p	CLASH	23622248
MIRT039843	hsa-miR-615-3p	CLASH	23622248
MIRT037378	hsa-miR-744-3p	CLASH	23622248
MIRT055863	hsa-miR-548ac	HITS-CLIP	19536157
MIRT055866	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT055857	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT055858	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT055862	hsa-miR-548z	HITS-CLIP	19536157
MIRT722422	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT722421	hsa-miR-885-5p	HITS-CLIP	19536157
MIRT722420	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722419	hsa-miR-587	HITS-CLIP	19536157
MIRT560494	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT560493	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT560492	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT560491	hsa-miR-633	PAR-CLIP	20371350
MIRT560490	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT261814	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT509219	hsa-miR-4476	PAR-CLIP	20371350
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT509217	hsa-miR-188-5p	PAR-CLIP	20371350
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	20371350
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT261817	hsa-miR-8065	PAR-CLIP	20371350
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT330018	hsa-miR-3674	PAR-CLIP	20371350
MIRT560494	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT560493	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT560492	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT560491	hsa-miR-633	PAR-CLIP	20371350
MIRT560490	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT261814	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT509219	hsa-miR-4476	PAR-CLIP	23446348
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT509217	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT261817	hsa-miR-8065	PAR-CLIP	23446348
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	23446348
MIRT261814	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT509219	hsa-miR-4476	PAR-CLIP	23446348
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT509217	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT261817	hsa-miR-8065	PAR-CLIP	23446348
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	23446348
MIRT261815	hsa-miR-4477b	PAR-CLIP	23446348
MIRT330018	hsa-miR-3674	PAR-CLIP	23446348
MIRT480592	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT480591	hsa-miR-1255b-2-3p	PAR-CLIP	23592263
MIRT480590	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT480589	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT480588	hsa-miR-3185	PAR-CLIP	23592263
MIRT480587	hsa-miR-6861-3p	PAR-CLIP	23592263
MIRT261800	hsa-miR-492	PAR-CLIP	23592263
MIRT480586	hsa-miR-659-5p	PAR-CLIP	23592263
MIRT261813	hsa-miR-8071	PAR-CLIP	23592263
MIRT261810	hsa-miR-4800-5p	PAR-CLIP	23592263
MIRT480585	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT261812	hsa-miR-6802-5p	PAR-CLIP	23592263
MIRT261801	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT480584	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT480583	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT261799	hsa-miR-106a-3p	PAR-CLIP	23592263
MIRT261806	hsa-miR-4535	PAR-CLIP	23592263
MIRT330080	hsa-miR-1276	PAR-CLIP	23592263
MIRT480582	hsa-miR-656-3p	PAR-CLIP	23592263
MIRT261787	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT480581	hsa-miR-3670	PAR-CLIP	23592263
MIRT480580	hsa-miR-520d-5p	PAR-CLIP	23592263
MIRT480579	hsa-miR-524-5p	PAR-CLIP	23592263
MIRT261820	hsa-miR-1303	PAR-CLIP	23592263
MIRT739756	hsa-miR-3653	HITS-CLIP	33718276
MIRT739757	hsa-miR-3658	HITS-CLIP	33718276
MIRT055863	hsa-miR-548ac	HITS-CLIP	19536157
MIRT055866	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT055857	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT055858	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT055862	hsa-miR-548z	HITS-CLIP	19536157
MIRT722422	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT722421	hsa-miR-885-5p	HITS-CLIP	19536157
MIRT722420	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722419	hsa-miR-587	HITS-CLIP	19536157
MIRT560494	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT560493	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT560492	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT560491	hsa-miR-633	PAR-CLIP	20371350
MIRT560490	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT261814	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT509219	hsa-miR-4476	PAR-CLIP	20371350
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT509217	hsa-miR-188-5p	PAR-CLIP	20371350
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	20371350
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT261817	hsa-miR-8065	PAR-CLIP	20371350
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT330018	hsa-miR-3674	PAR-CLIP	20371350
MIRT560494	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT560493	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT560492	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT560491	hsa-miR-633	PAR-CLIP	20371350
MIRT560490	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT261814	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT509219	hsa-miR-4476	PAR-CLIP	23446348
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT509217	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT261817	hsa-miR-8065	PAR-CLIP	23446348
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	23446348
MIRT261814	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT509219	hsa-miR-4476	PAR-CLIP	23446348
MIRT509218	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT509217	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT509216	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT330039	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT261817	hsa-miR-8065	PAR-CLIP	23446348
MIRT509215	hsa-miR-135b-3p	PAR-CLIP	23446348
MIRT261815	hsa-miR-4477b	PAR-CLIP	23446348
MIRT330018	hsa-miR-3674	PAR-CLIP	23446348
MIRT480592	hsa-miR-497-3p	PAR-CLIP	23592263
MIRT480591	hsa-miR-1255b-2-3p	PAR-CLIP	23592263
MIRT480590	hsa-miR-6815-5p	PAR-CLIP	23592263
MIRT480589	hsa-miR-6865-5p	PAR-CLIP	23592263
MIRT480588	hsa-miR-3185	PAR-CLIP	23592263
MIRT480587	hsa-miR-6861-3p	PAR-CLIP	23592263
MIRT261800	hsa-miR-492	PAR-CLIP	23592263
MIRT480586	hsa-miR-659-5p	PAR-CLIP	23592263
MIRT261813	hsa-miR-8071	PAR-CLIP	23592263
MIRT261810	hsa-miR-4800-5p	PAR-CLIP	23592263
MIRT480585	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT261812	hsa-miR-6802-5p	PAR-CLIP	23592263
MIRT261801	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT480584	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT480583	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT261799	hsa-miR-106a-3p	PAR-CLIP	23592263
MIRT261806	hsa-miR-4535	PAR-CLIP	23592263
MIRT330080	hsa-miR-1276	PAR-CLIP	23592263
MIRT480582	hsa-miR-656-3p	PAR-CLIP	23592263
MIRT261787	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT480581	hsa-miR-3670	PAR-CLIP	23592263
MIRT480580	hsa-miR-520d-5p	PAR-CLIP	23592263
MIRT480579	hsa-miR-524-5p	PAR-CLIP	23592263
MIRT261820	hsa-miR-1303	PAR-CLIP	23592263
MIRT827665	hsa-miR-1229	CLIP-seq
MIRT827666	hsa-miR-1237	CLIP-seq
MIRT827667	hsa-miR-1238	CLIP-seq
MIRT827668	hsa-miR-186	CLIP-seq
MIRT827669	hsa-miR-198	CLIP-seq
MIRT827670	hsa-miR-203	CLIP-seq
MIRT827671	hsa-miR-216a	CLIP-seq
MIRT827672	hsa-miR-24	CLIP-seq
MIRT827673	hsa-miR-3065-5p	CLIP-seq
MIRT827674	hsa-miR-3157-3p	CLIP-seq
MIRT827675	hsa-miR-3192	CLIP-seq
MIRT827676	hsa-miR-3646	CLIP-seq
MIRT827677	hsa-miR-369-3p	CLIP-seq
MIRT827678	hsa-miR-374a	CLIP-seq
MIRT827679	hsa-miR-374b	CLIP-seq
MIRT827680	hsa-miR-3973	CLIP-seq
MIRT827681	hsa-miR-3974	CLIP-seq
MIRT827682	hsa-miR-4274	CLIP-seq
MIRT827683	hsa-miR-4284	CLIP-seq
MIRT827684	hsa-miR-4314	CLIP-seq
MIRT827685	hsa-miR-4420	CLIP-seq
MIRT827686	hsa-miR-4432	CLIP-seq
MIRT827687	hsa-miR-450b-3p	CLIP-seq
MIRT827688	hsa-miR-4639-5p	CLIP-seq
MIRT827689	hsa-miR-4646-5p	CLIP-seq
MIRT827690	hsa-miR-4713-3p	CLIP-seq
MIRT827691	hsa-miR-4717-5p	CLIP-seq
MIRT827692	hsa-miR-4793-5p	CLIP-seq
MIRT827693	hsa-miR-5096	CLIP-seq
MIRT827694	hsa-miR-514	CLIP-seq
MIRT827695	hsa-miR-514b-3p	CLIP-seq
MIRT827696	hsa-miR-518a-5p	CLIP-seq
MIRT827697	hsa-miR-527	CLIP-seq
MIRT827698	hsa-miR-548l	CLIP-seq
MIRT827699	hsa-miR-548u	CLIP-seq
MIRT827700	hsa-miR-549	CLIP-seq
MIRT827701	hsa-miR-561	CLIP-seq
MIRT827702	hsa-miR-622	CLIP-seq
MIRT827703	hsa-miR-638	CLIP-seq
MIRT827704	hsa-miR-646	CLIP-seq
MIRT827705	hsa-miR-769-3p	CLIP-seq
MIRT827706	hsa-miR-874	CLIP-seq
MIRT827707	hsa-miR-938	CLIP-seq
MIRT827666	hsa-miR-1237	CLIP-seq
MIRT1944905	hsa-miR-1248	CLIP-seq
MIRT1944906	hsa-miR-3130-3p	CLIP-seq
MIRT827674	hsa-miR-3157-3p	CLIP-seq
MIRT1944907	hsa-miR-3664-3p	CLIP-seq
MIRT1944908	hsa-miR-3691-3p	CLIP-seq
MIRT1944909	hsa-miR-3919	CLIP-seq
MIRT1944910	hsa-miR-4686	CLIP-seq
MIRT1944911	hsa-miR-4704-3p	CLIP-seq
MIRT1944912	hsa-miR-4756-3p	CLIP-seq
MIRT1944913	hsa-miR-4793-3p	CLIP-seq
MIRT1944914	hsa-miR-510	CLIP-seq
MIRT1944915	hsa-miR-512-5p	CLIP-seq
MIRT827696	hsa-miR-518a-5p	CLIP-seq
MIRT827697	hsa-miR-527	CLIP-seq
MIRT1944916	hsa-miR-544	CLIP-seq
MIRT1944917	hsa-miR-590-3p	CLIP-seq
MIRT1944918	hsa-miR-873	CLIP-seq
MIRT827706	hsa-miR-874	CLIP-seq
MIRT2183428	hsa-miR-1183	CLIP-seq
MIRT2183429	hsa-miR-2110	CLIP-seq
MIRT2183430	hsa-miR-219-2-3p	CLIP-seq
MIRT827672	hsa-miR-24	CLIP-seq
MIRT2183431	hsa-miR-3120-5p	CLIP-seq
MIRT2183432	hsa-miR-3150a-3p	CLIP-seq
MIRT2183433	hsa-miR-3154	CLIP-seq
MIRT2183434	hsa-miR-3175	CLIP-seq
MIRT2183435	hsa-miR-3179	CLIP-seq
MIRT2183436	hsa-miR-3194-3p	CLIP-seq
MIRT2183437	hsa-miR-3662	CLIP-seq
MIRT2183438	hsa-miR-371-5p	CLIP-seq
MIRT2183439	hsa-miR-378g	CLIP-seq
MIRT827681	hsa-miR-3974	CLIP-seq
MIRT827683	hsa-miR-4284	CLIP-seq
MIRT2183440	hsa-miR-4494	CLIP-seq
MIRT2183441	hsa-miR-4698	CLIP-seq
MIRT2183442	hsa-miR-4699-3p	CLIP-seq
MIRT1944911	hsa-miR-4704-3p	CLIP-seq
MIRT2183443	hsa-miR-4719	CLIP-seq
MIRT2183444	hsa-miR-4766-3p	CLIP-seq
MIRT2183445	hsa-miR-4795-3p	CLIP-seq
MIRT2183446	hsa-miR-499a-5p	CLIP-seq
MIRT2183447	hsa-miR-511	CLIP-seq
MIRT2183448	hsa-miR-545	CLIP-seq
MIRT2183449	hsa-miR-548g	CLIP-seq
MIRT2183450	hsa-miR-548p	CLIP-seq
MIRT2183451	hsa-miR-582-5p	CLIP-seq
MIRT2183452	hsa-miR-598	CLIP-seq
MIRT2183453	hsa-miR-605	CLIP-seq
MIRT2183454	hsa-miR-634	CLIP-seq
MIRT2183455	hsa-miR-939	CLIP-seq
MIRT827666	hsa-miR-1237	CLIP-seq
MIRT1944905	hsa-miR-1248	CLIP-seq
MIRT2487067	hsa-miR-1266	CLIP-seq
MIRT827668	hsa-miR-186	CLIP-seq
MIRT827670	hsa-miR-203	CLIP-seq
MIRT827671	hsa-miR-216a	CLIP-seq
MIRT2487068	hsa-miR-27a	CLIP-seq
MIRT2487069	hsa-miR-27b	CLIP-seq
MIRT827673	hsa-miR-3065-5p	CLIP-seq
MIRT2487070	hsa-miR-30a	CLIP-seq
MIRT2487071	hsa-miR-30b	CLIP-seq
MIRT2487072	hsa-miR-30c	CLIP-seq
MIRT2487073	hsa-miR-30d	CLIP-seq
MIRT2487074	hsa-miR-30e	CLIP-seq
MIRT2487075	hsa-miR-3123	CLIP-seq
MIRT1944906	hsa-miR-3130-3p	CLIP-seq
MIRT2487076	hsa-miR-3145-3p	CLIP-seq
MIRT827674	hsa-miR-3157-3p	CLIP-seq
MIRT2487077	hsa-miR-3163	CLIP-seq
MIRT827675	hsa-miR-3192	CLIP-seq
MIRT2487078	hsa-miR-3614-5p	CLIP-seq
MIRT2183437	hsa-miR-3662	CLIP-seq
MIRT1944907	hsa-miR-3664-3p	CLIP-seq
MIRT2487079	hsa-miR-3667-5p	CLIP-seq
MIRT1944908	hsa-miR-3691-3p	CLIP-seq
MIRT2487080	hsa-miR-380	CLIP-seq
MIRT1944909	hsa-miR-3919	CLIP-seq
MIRT2487081	hsa-miR-3925-5p	CLIP-seq
MIRT2487082	hsa-miR-3976	CLIP-seq
MIRT2487083	hsa-miR-409-3p	CLIP-seq
MIRT2487084	hsa-miR-410	CLIP-seq
MIRT2487085	hsa-miR-4266	CLIP-seq
MIRT827684	hsa-miR-4314	CLIP-seq
MIRT2487086	hsa-miR-4418	CLIP-seq
MIRT827685	hsa-miR-4420	CLIP-seq
MIRT2487087	hsa-miR-4495	CLIP-seq
MIRT827687	hsa-miR-450b-3p	CLIP-seq
MIRT2487088	hsa-miR-4511	CLIP-seq
MIRT2487089	hsa-miR-4518	CLIP-seq
MIRT827688	hsa-miR-4639-5p	CLIP-seq
MIRT827689	hsa-miR-4646-5p	CLIP-seq
MIRT2487090	hsa-miR-4661-5p	CLIP-seq
MIRT2487091	hsa-miR-4694-3p	CLIP-seq
MIRT2487092	hsa-miR-4695-5p	CLIP-seq
MIRT2183441	hsa-miR-4698	CLIP-seq
MIRT1944911	hsa-miR-4704-3p	CLIP-seq
MIRT827690	hsa-miR-4713-3p	CLIP-seq
MIRT827691	hsa-miR-4717-5p	CLIP-seq
MIRT2183443	hsa-miR-4719	CLIP-seq
MIRT2487093	hsa-miR-4742-3p	CLIP-seq
MIRT1944912	hsa-miR-4756-3p	CLIP-seq
MIRT2487094	hsa-miR-4779	CLIP-seq
MIRT1944913	hsa-miR-4793-3p	CLIP-seq
MIRT2487095	hsa-miR-499-3p	CLIP-seq
MIRT2487096	hsa-miR-499a-3p	CLIP-seq
MIRT2487097	hsa-miR-509-3-5p	CLIP-seq
MIRT2487098	hsa-miR-509-5p	CLIP-seq
MIRT827693	hsa-miR-5096	CLIP-seq
MIRT2487099	hsa-miR-539	CLIP-seq
MIRT1944916	hsa-miR-544	CLIP-seq
MIRT2487100	hsa-miR-548b-3p	CLIP-seq
MIRT827700	hsa-miR-549	CLIP-seq
MIRT2487101	hsa-miR-570	CLIP-seq
MIRT2183451	hsa-miR-582-5p	CLIP-seq
MIRT827703	hsa-miR-638	CLIP-seq
MIRT827705	hsa-miR-769-3p	CLIP-seq
MIRT1944918	hsa-miR-873	CLIP-seq
MIRT827706	hsa-miR-874	CLIP-seq
MIRT827707	hsa-miR-938	CLIP-seq
MIRT2487102	hsa-miR-942	CLIP-seq
MIRT827665	hsa-miR-1229	CLIP-seq
MIRT827666	hsa-miR-1237	CLIP-seq
MIRT1944905	hsa-miR-1248	CLIP-seq
MIRT827668	hsa-miR-186	CLIP-seq
MIRT827670	hsa-miR-203	CLIP-seq
MIRT827671	hsa-miR-216a	CLIP-seq
MIRT2487068	hsa-miR-27a	CLIP-seq
MIRT2487069	hsa-miR-27b	CLIP-seq
MIRT2487070	hsa-miR-30a	CLIP-seq
MIRT2487071	hsa-miR-30b	CLIP-seq
MIRT2487072	hsa-miR-30c	CLIP-seq
MIRT2487073	hsa-miR-30d	CLIP-seq
MIRT2487074	hsa-miR-30e	CLIP-seq
MIRT2487075	hsa-miR-3123	CLIP-seq
MIRT1944906	hsa-miR-3130-3p	CLIP-seq
MIRT2487076	hsa-miR-3145-3p	CLIP-seq
MIRT827674	hsa-miR-3157-3p	CLIP-seq
MIRT827675	hsa-miR-3192	CLIP-seq
MIRT2183437	hsa-miR-3662	CLIP-seq
MIRT2487079	hsa-miR-3667-5p	CLIP-seq
MIRT2487080	hsa-miR-380	CLIP-seq
MIRT1944909	hsa-miR-3919	CLIP-seq
MIRT2487081	hsa-miR-3925-5p	CLIP-seq
MIRT2487082	hsa-miR-3976	CLIP-seq
MIRT2487083	hsa-miR-409-3p	CLIP-seq
MIRT2487084	hsa-miR-410	CLIP-seq
MIRT2487085	hsa-miR-4266	CLIP-seq
MIRT827684	hsa-miR-4314	CLIP-seq
MIRT827685	hsa-miR-4420	CLIP-seq
MIRT2487087	hsa-miR-4495	CLIP-seq
MIRT827687	hsa-miR-450b-3p	CLIP-seq
MIRT2487088	hsa-miR-4511	CLIP-seq
MIRT827688	hsa-miR-4639-5p	CLIP-seq
MIRT827689	hsa-miR-4646-5p	CLIP-seq
MIRT2487090	hsa-miR-4661-5p	CLIP-seq
MIRT2487091	hsa-miR-4694-3p	CLIP-seq
MIRT2487092	hsa-miR-4695-5p	CLIP-seq
MIRT2183441	hsa-miR-4698	CLIP-seq
MIRT1944911	hsa-miR-4704-3p	CLIP-seq
MIRT827690	hsa-miR-4713-3p	CLIP-seq
MIRT2183443	hsa-miR-4719	CLIP-seq
MIRT2487093	hsa-miR-4742-3p	CLIP-seq
MIRT1944912	hsa-miR-4756-3p	CLIP-seq
MIRT2676237	hsa-miR-4760-3p	CLIP-seq
MIRT2676238	hsa-miR-4775	CLIP-seq
MIRT2487094	hsa-miR-4779	CLIP-seq
MIRT1944913	hsa-miR-4793-3p	CLIP-seq
MIRT2487095	hsa-miR-499-3p	CLIP-seq
MIRT2487096	hsa-miR-499a-3p	CLIP-seq
MIRT827693	hsa-miR-5096	CLIP-seq
MIRT2487099	hsa-miR-539	CLIP-seq
MIRT1944916	hsa-miR-544	CLIP-seq
MIRT2487100	hsa-miR-548b-3p	CLIP-seq
MIRT2487101	hsa-miR-570	CLIP-seq
MIRT2183451	hsa-miR-582-5p	CLIP-seq
MIRT1944917	hsa-miR-590-3p	CLIP-seq
MIRT827703	hsa-miR-638	CLIP-seq
MIRT2676239	hsa-miR-664	CLIP-seq
MIRT827705	hsa-miR-769-3p	CLIP-seq
MIRT827706	hsa-miR-874	CLIP-seq
MIRT827707	hsa-miR-938	CLIP-seq
MIRT2487102	hsa-miR-942	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	9660858
GO:0000776	Component	Kinetochore	IEA
GO:0005515	Function	Protein binding	IPI	9660858, 10198256, 11283619, 12762840, 15525512, 17289665, 19407811, 21566117, 21988832, 22000412, 22365833, 24462186, 24462187, 25383541, 25416956, 25852190, 25959826, 26496610, 32707033, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007059	Process	Chromosome segregation	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IBA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	NAS	11535616
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IDA	18199686
GO:0033597	Component	Mitotic checkpoint complex	IBA
GO:0033597	Component	Mitotic checkpoint complex	IPI	27509861
GO:0034501	Process	Protein localization to kinetochore	IPI	9660858
GO:0043130	Function	Ubiquitin binding	IBA
GO:0051301	Process	Cell division	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051983	Process	Regulation of chromosome segregation	IEA
GO:1990298	Component	Bub1-bub3 complex	IBA

MIM	HGNC	e!Ensembl
603719	1151	ENSG00000154473

O43684

Protein name

Mitotic checkpoint protein BUB3

Protein function

Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localiz

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	4 → 43	WD domain, G-beta repeat	Repeat
PF00400	WD40	88 → 124	WD domain, G-beta repeat	Repeat
PF00400	WD40	215 → 262	WD domain, G-beta repeat	Repeat

Sequence

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKSPCT

Sequence length

328

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Cdc20:Phospho-APC/C mediated degradation of Cyclin A APC/C:Cdc20 mediated degradation of mitotic proteins APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BUB3-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOSAIC VARIEGATED ANEUPLOIDY SYNDROME	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	29448935, 33564066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11400114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24711138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35186236, 35493295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12692836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32596342, 35493295, 37301543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	26398519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23747338, 27713038, 29448935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29448935, 35156516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal atresia	Duodenal Atresia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Elliptocytosis 1	Hereditary elliptocytosis	Pubtator	29448935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18383837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11355300, 23728478, 24316223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18694480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23728478, 24316223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22022424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37535603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30866167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11400114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24711138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11146226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30866167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30553276, 31783872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31801961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12692836, 28843004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11400114, 15796961, 16760651, 30413320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24743044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
mosaic variegated aneuploidy	Mosaic Variegated Aneuploidy	BEFREE	23747338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic Variegated Aneuploidy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mosaic variegated aneuploidy syndrome	Mosaic Variegated Aneuploidy	BEFREE	29448935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	29448935	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mosaic variegated aneuploidy syndrome 1	Mosaic Variegated Aneuploidy	ORPHANET_DG	23747338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome 1	Mosaic Variegated Aneuploidy	BEFREE	29448935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31801961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15796961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15796961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30553276, 31783872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28767289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18383837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31801961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31801961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33872216, 35493295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30866167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12692836, 28843004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subaortic stenosis	Subaortic Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18383837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35056723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

BUB3 (BUB3 mitotic checkpoint protein)