Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9177
Gene name	5-hydroxytryptamine receptor 3B
Gene symbol	HTR3B
Synonyms (NCBI Gene)	5-HT3B
Chromosome	11
Chromosome location	11q23.2
Summary	The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT1057245	hsa-miR-129-5p	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT1057249	hsa-miR-3672	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013082	hsa-miR-1343	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013086	hsa-miR-378g	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT2013089	hsa-miR-4437	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT2013090	hsa-miR-4674	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013082	hsa-miR-1343	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT2245371	hsa-miR-1976	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2245372	hsa-miR-370	CLIP-seq
MIRT2013086	hsa-miR-378g	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT2013089	hsa-miR-4437	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT2013090	hsa-miR-4674	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21138434
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0009986	Component	Cell surface	IDA	16571125
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	7565620, 9950429
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IGI	9950429
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	9950429
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IGI	9950429
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	16116092

MIM	HGNC	e!Ensembl
604654	5298	ENSG00000149305

O95264

Protein name

5-hydroxytryptamine receptor 3B (5-HT3-B) (5-HT3B) (Serotonin receptor 3B)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	32 → 239	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	246 → 340	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain cortex, in the caudate nucleus, the hippocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and plac

Sequence

MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV

Sequence length

441

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anorexia	Anorexia	BEFREE	19741568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	19741568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	19185213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	19185213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15389765, 22832903, 27706728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15389765, 22832903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	27063557	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bulimia Nervosa	Bulimia	BEFREE	19741568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19741568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19741568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	36849934	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31152805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	16314763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	LHGDN	16314763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	36849934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	35800179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	15389765, 22832903		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	15389765, 22832903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	22832903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	15389765, 22832903		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	15389765, 22832903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16487942, 18184810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	16487942, 18184810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	19741568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19741568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	16487942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16487942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CTD_human_DG	17600820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nausea	Nausea	Pubtator	33794950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27616601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	25217961, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15389765, 16487942, 20356718, 21184810, 27654063		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20356718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	16487942, 18184810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	16487942, 18184810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

HTR3B (5-hydroxytryptamine receptor 3B)