ZNF804A (zinc finger protein 804A)

Gene

• Entrez ID: 91752
• Gene name: Zinc finger protein 804A
• Gene symbol: ZNF804A
• Synonyms (NCBI Gene): C2orf10
• Chromosome: 2
• Chromosome location: 2q32.1
• Summary: The protein encoded by this gene is a zinc finger binding protein. Polymorphisms in this gene, especially rs1344706, are thought to confer increased susceptibility to schizophrenia, bipolar disorder, and heroin addiciton. [provided by RefSeq, Nov 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540376	hsa-miR-3646	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT2382292	hsa-miR-4803	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	27837918
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	27837918
GO:0005886	Component	Plasma membrane	IDA	27837918
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	27837918
GO:0010975	Process	Regulation of neuron projection development	IGI	27837918
GO:0010976	Process	Positive regulation of neuron projection development	IMP	27837918
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IDA	27837918
GO:0043025	Component	Neuronal cell body	IDA	27837918
GO:0043025	Component	Neuronal cell body	IEA
GO:0043197	Component	Dendritic spine	IDA	27837918
GO:0043197	Component	Dendritic spine	IEA
GO:0043198	Component	Dendritic shaft	IDA	27837918
GO:0043198	Component	Dendritic shaft	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IDA	27837918
GO:0098794	Component	Postsynapse	IEA
GO:1901588	Component	Dendritic microtubule	IDA	27837918
GO:1902952	Process	Positive regulation of dendritic spine maintenance	IEA

Other IDs

• MIM: 612282
• HGNC: 21711
• e!Ensembl: ENSG00000170396

Protein

• UniProt ID: Q7Z570
• Protein name: Zinc finger protein 804A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12171	zf-C2H2_jaz	56 → 84	Zinc-finger double-stranded RNA-binding	Family

• Sequence:

  MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCE
  LCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKL
  AELRKETVCAPGSGPMFKSTTVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDA
  TTVAEDPESANNYTAKNNQVGDQAQGIHRHKIGFSFAFPKKASVKLESSAAAFSEYSDDA
  SVGKGFSRKSRFVPSACHLQQSSPTDVLLSSEEKTNSFHPPEAMCRDKETVQTQEIKEVS
  SEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVVINEDIPVSGNSFELLGNKS
  TVLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLAPSNTEEVNITIHKKTNFCKR
  QCEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDL
  KDLCSQQKQEDICMGPLSDYKDVSTEGLTDYEIGSSKNKCSQVTPLLADDILSSSCDSGK
  NENTGQRYKNISCKIRETEKYNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRK
  KLCQHHHMEKTKESETRCKMEAENSYTENAGKYLLEPISEKQYLAAEQLLDSHQLLDKRP
  KSESISLSDNEEMCKTWNTEYNTYDTISSKNHCKKNTILLNGQSNATMIHSGKHNLTYSR
  TYCCWKTKMSSCSQDHRSLVLQNDMKHMSQNQAVKRGYNSVMNESERFYRKRRQHSHSYS
  SDESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPVKDNS
  SLNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEM
  ETTSGELSDVSNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERN
  FRQSQPKSYLCHYELAEALPQGKMNETPTEWLRYNSGILNTQPPLPFKEAHVSGHTFVTA
  EQILAPLALPEQALLIPLENHDKFKNVPCEVYQHILQPNMLANKVKFTFPPAALPPPSTP
  LQPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAGTFKVLQPHQQFLSQIPALTR
  TSLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHALFPSLLSPHP
  TVIPLQPLF

• Sequence length: 1209

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROTATOR CUFF TEAR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER-BIPOLAR TYPE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ZNF804A-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety Disorder	BEFREE	20048749		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	20048749	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20048749		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	24866414	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31076262		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23351715	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21276201, 25667193, 31076262		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attenuated familial adenomatous polyposis	Adenomatous polyposis	Pubtator	23155182	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21915259, 22543975, 24736721, 25905630, 30597088, 30670685	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21915259, 30597088, 30670685		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	19329560, 24866414, 31122238, 31294817		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24866414, 31294817	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28740209		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23351715	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25935703		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18677311, 19329560, 19521722, 20048749, 20368704, 21040459, 21767209, 21915259, 22042765, 22775511, 22840435, 23155182, 23562677, 24123948, 24315717, 24636489, 24685285, 25162540, 25522715, 25858580, 25935703, 27784192, 27790829, 27837918, 28120939, 28544350, 28648753, 30079586, 30597088, 31727397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	19329560, 20048749, 20368704, 21040459, 21525856, 21915259, 22042765, 22840435, 23155182, 23351715, 24315717, 24625750, 24685285, 25162540, 25905630, 27790829, 28120939, 29257977, 30079586, 30597088	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23155182, 23786914, 24315717, 25162540, 25522715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	29121268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	28544350		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21767209, 27784192		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21767209, 27784192		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22373944	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34321086	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25162540	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	21525856	Associate	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	22781169		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	19329560		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	19329560	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28740209	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28740209	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25162540, 27784192, 29112096, 30626913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30626913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	20048749, 25732148, 29112096, 30670685		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	21276201, 21302348, 27784192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21276201, 21302348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	32626976	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	22521361		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	20048749, 20231838, 20603450, 20688871, 20934520, 20957649, 21040459, 21767209, 21946175, 22042765, 22080834, 22328493, 22840435, 23155182, 23295962, 23562677, 24247043, 24828433, 25162540, 25667193, 25708696, 25757652, 25896933, 26670283, 27837918, 28544350, 28931092, 29257977, 30079586, 30118824		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	BEFREE	23155182		★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	23155182	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30597088, 30670685		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	20048749, 20231838, 20603450, 20688871, 20934520, 20957649, 21040459, 21525856, 21767209, 21946175, 22042765, 22080834, 22328493, 22840435, 23155182, 23295962, 23562677, 24247043, 24828433, 25162540, 25667193, 25708696, 25757652, 25896933, 26670283, 27837918, 28544350, 28931092, 29247760, 29257977, 30079586, 30118824		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	20048749, 21040459, 21525856, 22042765, 22840435, 23155182, 23351715, 24828433, 25162540, 29257977, 30079586	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	18677311, 25056061, 26198764, 28991256, 29121268, 29483656, 30285260, 30626913, 31268507, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	18677311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18677311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	19329560, 19407193, 19521722, 19818200, 19844207, 20048749, 20368704, 20457675, 20603450, 20664580, 20688871, 20862696, 20934321, 20934520, 20957649, 21037240, 21040459, 21302348, 21349497, 21457757, 21767209, 21810628, 21890790, 21892778, 21911029, 21915259, 21946175, 21988329, 21993378, 22042765, 22328493, 22373944, 22384243, 22425527, 22499782, 22775511, 22781169, 22840435, 22871346, 22887939, 22945618, 22948380, 23147122, 23155182, 23212061, 23295962, 23562677, 23590871, 23776546, 24078172, 24123948, 24315717, 24424391, 24424392, 24625750, 24636489, 24685285, 24686180, 25065377, 25162540, 25217366, 25522715, 25526981, 25667193, 25757652, 25858580, 25921517, 26498712, 26654932, 26670283, 26866941, 26934312, 27784192, 27790829, 27837918, 28078547, 28120939, 28289284, 28544350, 28924186, 28931092, 29055568, 29112096, 29247760, 29611035, 30079586, 30597088, 30852803, 31076262, 31122238, 31294817, 31464994		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19329560, 20048749, 20368704, 20664580, 21040459, 21525856, 22042765, 22373944, 22781169, 22840435, 22883350, 23155182, 23351715, 24078172, 24315717, 24447899, 24625750, 24685285, 24736721, 24828433, 25162540, 25905630, 26498712, 27790829, 28120939, 29257977, 30079586, 30597088, 30626913, 31122238, 31294817, 32059228, 32626976	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndactyly	Syndactyly	BEFREE	28600059		★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	Pubtator	28600059	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25162540, 27784192, 29112096		★☆☆☆☆ Found in Text Mining only