Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	91734
Gene name	Isopentenyl-diphosphate delta isomerase 2
Gene symbol	IDI2
Synonyms (NCBI Gene)	IPPI2
Chromosome	10
Chromosome location	10p15.3
Summary	The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments
MIRT1059488	hsa-miR-1261	CLIP-seq
MIRT1059489	hsa-miR-3150a-3p	CLIP-seq
MIRT1059490	hsa-miR-3151	CLIP-seq
MIRT1059491	hsa-miR-3175	CLIP-seq
MIRT1059492	hsa-miR-320a	CLIP-seq
MIRT1059493	hsa-miR-320b	CLIP-seq
MIRT1059494	hsa-miR-320c	CLIP-seq
MIRT1059495	hsa-miR-320d	CLIP-seq
MIRT1059496	hsa-miR-4429	CLIP-seq
MIRT1059497	hsa-miR-4447	CLIP-seq
MIRT1059498	hsa-miR-4472	CLIP-seq
MIRT1059499	hsa-miR-491-5p	CLIP-seq
MIRT1059500	hsa-miR-939	CLIP-seq
MIRT2013856	hsa-miR-1207-3p	CLIP-seq
MIRT2451581	hsa-miR-146b-3p	CLIP-seq
MIRT2451582	hsa-miR-3157-3p	CLIP-seq
MIRT2451583	hsa-miR-3173-5p	CLIP-seq
MIRT2451584	hsa-miR-371b-3p	CLIP-seq
MIRT2451585	hsa-miR-4749-3p	CLIP-seq
MIRT2451586	hsa-miR-4789-5p	CLIP-seq
MIRT2451587	hsa-miR-874	CLIP-seq
MIRT2549169	hsa-miR-105	CLIP-seq
MIRT1059488	hsa-miR-1261	CLIP-seq
MIRT2549170	hsa-miR-1265	CLIP-seq
MIRT2549171	hsa-miR-2392	CLIP-seq
MIRT2549172	hsa-miR-346	CLIP-seq
MIRT2549173	hsa-miR-3614-5p	CLIP-seq
MIRT2549174	hsa-miR-3616-3p	CLIP-seq
MIRT2549175	hsa-miR-3646	CLIP-seq
MIRT2549176	hsa-miR-3678-5p	CLIP-seq
MIRT2549177	hsa-miR-3681	CLIP-seq
MIRT2549178	hsa-miR-4329	CLIP-seq
MIRT2549179	hsa-miR-4466	CLIP-seq
MIRT2549180	hsa-miR-4696	CLIP-seq
MIRT2549181	hsa-miR-4721	CLIP-seq
MIRT2549182	hsa-miR-4763-5p	CLIP-seq
MIRT2549183	hsa-miR-4786-5p	CLIP-seq
MIRT2549184	hsa-miR-4793-3p	CLIP-seq
MIRT2549185	hsa-miR-4795-5p	CLIP-seq
MIRT2549186	hsa-miR-643	CLIP-seq
MIRT2549187	hsa-miR-647	CLIP-seq
MIRT2549188	hsa-miR-651	CLIP-seq
MIRT2549189	hsa-miR-675	CLIP-seq
MIRT2549190	hsa-miR-769-5p	CLIP-seq
MIRT2549172	hsa-miR-346	CLIP-seq
MIRT2549174	hsa-miR-3616-3p	CLIP-seq
MIRT2549179	hsa-miR-4466	CLIP-seq
MIRT2549181	hsa-miR-4721	CLIP-seq
MIRT2549182	hsa-miR-4763-5p	CLIP-seq
MIRT2549184	hsa-miR-4793-3p	CLIP-seq
MIRT2549189	hsa-miR-675	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004452	Function	Isopentenyl-diphosphate delta-isomerase activity	IBA
GO:0004452	Function	Isopentenyl-diphosphate delta-isomerase activity	IDA	17202134
GO:0004452	Function	Isopentenyl-diphosphate delta-isomerase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005777	Component	Peroxisome	IDA	17202134
GO:0005777	Component	Peroxisome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006695	Process	Cholesterol biosynthetic process	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008299	Process	Isoprenoid biosynthetic process	IDA	17202134
GO:0008299	Process	Isoprenoid biosynthetic process	IEA
GO:0009240	Process	Isopentenyl diphosphate biosynthetic process	IBA
GO:0016126	Process	Sterol biosynthetic process	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0016860	Function	Intramolecular oxidoreductase activity	IEA
GO:0046490	Process	Isopentenyl diphosphate metabolic process	IDA	17202134
GO:0046872	Function	Metal ion binding	IEA
GO:0050992	Process	Dimethylallyl diphosphate biosynthetic process	IEA

MIM	HGNC	e!Ensembl
615389	23487	ENSG00000148377

Q9BXS1

Protein name

Isopentenyl-diphosphate delta-isomerase 2 (EC 5.3.3.2) (Isopentenyl pyrophosphate isomerase 2) (IPP isomerase 2) (IPPI2)

Protein function

Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).

PDB

2PNY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00293	NUDIX	49 → 197	NUDIX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Muscle-specific expression. {ECO:0000269|PubMed:17202134}.

Sequence

MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFN
TKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPG
EQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELW
ELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV

Sequence length

227

Interactions

View interactions

	KEGG		Reactome
	Terpenoid backbone biosynthesis Metabolic pathways		Cholesterol biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	20955688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	32727980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	26831199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37671354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IDI2 (isopentenyl-diphosphate delta isomerase 2)