IL1RL1 (interleukin 1 receptor like 1)

Gene

• Entrez ID: 9173
• Gene name: Interleukin 1 receptor like 1
• Gene symbol: IL1RL1
• Synonyms (NCBI Gene): DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
• Chromosome: 2
• Chromosome location: 2q12.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029172	hsa-miR-26b-5p	Microarray	19088304
MIRT1064418	hsa-miR-149	CLIP-seq
MIRT1064419	hsa-miR-3064-5p	CLIP-seq
MIRT1064420	hsa-miR-3065-5p	CLIP-seq
MIRT1064421	hsa-miR-3126-3p	CLIP-seq
MIRT1064422	hsa-miR-3164	CLIP-seq
MIRT1064423	hsa-miR-4687-3p	CLIP-seq
MIRT1064424	hsa-miR-4704-3p	CLIP-seq
MIRT1064425	hsa-miR-4794	CLIP-seq
MIRT1064426	hsa-miR-505	CLIP-seq
MIRT1064427	hsa-miR-617	CLIP-seq
MIRT1064428	hsa-miR-4434	CLIP-seq
MIRT1064429	hsa-miR-4516	CLIP-seq
MIRT2015304	hsa-miR-1237	CLIP-seq
MIRT2015305	hsa-miR-143	CLIP-seq
MIRT2015306	hsa-miR-193a-5p	CLIP-seq
MIRT2015307	hsa-miR-23a	CLIP-seq
MIRT2015308	hsa-miR-23b	CLIP-seq
MIRT2015309	hsa-miR-23c	CLIP-seq
MIRT2015310	hsa-miR-2964a-5p	CLIP-seq
MIRT2015311	hsa-miR-298	CLIP-seq
MIRT2015312	hsa-miR-3074-5p	CLIP-seq
MIRT2015313	hsa-miR-3152-5p	CLIP-seq
MIRT2015314	hsa-miR-3158-5p	CLIP-seq
MIRT2015315	hsa-miR-4297	CLIP-seq
MIRT2015316	hsa-miR-4326	CLIP-seq
MIRT2015317	hsa-miR-4426	CLIP-seq
MIRT2015318	hsa-miR-4647	CLIP-seq
MIRT2015319	hsa-miR-4659a-5p	CLIP-seq
MIRT2015320	hsa-miR-4659b-5p	CLIP-seq
MIRT2015321	hsa-miR-4662b	CLIP-seq
MIRT2015322	hsa-miR-4677-3p	CLIP-seq
MIRT2015323	hsa-miR-4722-3p	CLIP-seq
MIRT2015324	hsa-miR-4727-5p	CLIP-seq
MIRT2015325	hsa-miR-4769-3p	CLIP-seq
MIRT2015326	hsa-miR-4770	CLIP-seq
MIRT2015327	hsa-miR-4774-3p	CLIP-seq
MIRT2015328	hsa-miR-584	CLIP-seq
MIRT2015329	hsa-miR-596	CLIP-seq
MIRT2015330	hsa-miR-7	CLIP-seq
MIRT2247656	hsa-miR-1266	CLIP-seq
MIRT2247657	hsa-miR-3074-3p	CLIP-seq
MIRT2247658	hsa-miR-3130-5p	CLIP-seq
MIRT2247659	hsa-miR-3664-3p	CLIP-seq
MIRT2247660	hsa-miR-4419a	CLIP-seq
MIRT2247661	hsa-miR-4456	CLIP-seq
MIRT2247662	hsa-miR-4482	CLIP-seq
MIRT2247663	hsa-miR-4510	CLIP-seq
MIRT2247664	hsa-miR-4518	CLIP-seq
MIRT2247665	hsa-miR-4678	CLIP-seq
MIRT2247666	hsa-miR-541	CLIP-seq
MIRT2247667	hsa-miR-654-5p	CLIP-seq
MIRT2451734	hsa-miR-148a	CLIP-seq
MIRT2451735	hsa-miR-148b	CLIP-seq
MIRT2451736	hsa-miR-152	CLIP-seq
MIRT2451737	hsa-miR-1909	CLIP-seq
MIRT2451738	hsa-miR-342-3p	CLIP-seq
MIRT2451739	hsa-miR-3945	CLIP-seq
MIRT2451740	hsa-miR-4276	CLIP-seq
MIRT2451741	hsa-miR-4688	CLIP-seq
MIRT2551063	hsa-miR-124	CLIP-seq
MIRT2551064	hsa-miR-142-5p	CLIP-seq
MIRT1064418	hsa-miR-149	CLIP-seq
MIRT2551065	hsa-miR-1825	CLIP-seq
MIRT2551066	hsa-miR-1972	CLIP-seq
MIRT2551067	hsa-miR-221	CLIP-seq
MIRT2551068	hsa-miR-222	CLIP-seq
MIRT1064419	hsa-miR-3064-5p	CLIP-seq
MIRT1064421	hsa-miR-3126-3p	CLIP-seq
MIRT2551069	hsa-miR-3134	CLIP-seq
MIRT2551070	hsa-miR-3183	CLIP-seq
MIRT2551071	hsa-miR-331-5p	CLIP-seq
MIRT2551072	hsa-miR-3659	CLIP-seq
MIRT2551073	hsa-miR-3688-5p	CLIP-seq
MIRT2551074	hsa-miR-3714	CLIP-seq
MIRT2551075	hsa-miR-3910	CLIP-seq
MIRT2551076	hsa-miR-4255	CLIP-seq
MIRT2551077	hsa-miR-4266	CLIP-seq
MIRT2451740	hsa-miR-4276	CLIP-seq
MIRT2551078	hsa-miR-4302	CLIP-seq
MIRT2551079	hsa-miR-4305	CLIP-seq
MIRT2551080	hsa-miR-431	CLIP-seq
MIRT2247660	hsa-miR-4419a	CLIP-seq
MIRT2551081	hsa-miR-4501	CLIP-seq
MIRT2247663	hsa-miR-4510	CLIP-seq
MIRT2551082	hsa-miR-4534	CLIP-seq
MIRT2551083	hsa-miR-4658	CLIP-seq
MIRT1064423	hsa-miR-4687-3p	CLIP-seq
MIRT2551084	hsa-miR-4695-5p	CLIP-seq
MIRT2551085	hsa-miR-4723-3p	CLIP-seq
MIRT2551086	hsa-miR-4777-5p	CLIP-seq
MIRT2551087	hsa-miR-4779	CLIP-seq
MIRT1064425	hsa-miR-4794	CLIP-seq
MIRT2551088	hsa-miR-506	CLIP-seq
MIRT2551089	hsa-miR-511	CLIP-seq
MIRT2551090	hsa-miR-518d-5p	CLIP-seq
MIRT2551091	hsa-miR-519b-5p	CLIP-seq
MIRT2551092	hsa-miR-519c-5p	CLIP-seq
MIRT2551093	hsa-miR-520c-5p	CLIP-seq
MIRT2551094	hsa-miR-526a	CLIP-seq
MIRT2551095	hsa-miR-548v	CLIP-seq
MIRT2551096	hsa-miR-561	CLIP-seq
MIRT2551097	hsa-miR-570	CLIP-seq
MIRT2551098	hsa-miR-574-5p	CLIP-seq
MIRT1064427	hsa-miR-617	CLIP-seq
MIRT2551099	hsa-miR-642b	CLIP-seq
MIRT2551100	hsa-miR-644	CLIP-seq
MIRT2551101	hsa-miR-646	CLIP-seq
MIRT2551102	hsa-miR-890	CLIP-seq
MIRT2551101	hsa-miR-646	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA1	Unknown	22865859
GATA2	Unknown	22865859

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002113	Function	Interleukin-33 binding	IBA
GO:0002113	Function	Interleukin-33 binding	IEA
GO:0002114	Function	Interleukin-33 receptor activity	IDA	16286016
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004896	Function	Cytokine receptor activity	TAS	10191101
GO:0004908	Function	Interleukin-1 receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	8621446, 16286016, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	16286016
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IDA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0006955	Process	Immune response	NAS	10527832
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1482686
GO:0009611	Process	Response to wounding	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IBA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	11960013, 17675517, 18802081, 20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	16286016
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA

Other IDs

• MIM: 601203
• HGNC: 5998
• e!Ensembl: ENSG00000115602

Protein

• UniProt ID: Q01638
• Protein name: Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)
• Protein function: Receptor for interleukin-33 (IL-33) which plays crucial roles in innate and adaptive immunity, contributing to tissue homeostasis and responses to environmental stresses together with coreceptor IL1RAP (PubMed:35238669). Its stimulation recruits
• PDB: 4KC3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	18 → 104	Immunoglobulin I-set domain	Domain
  PF01582	TIR	379 → 556	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and t
• Sequence:

  MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
  ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
  TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
  CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
  KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
  YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
  WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
  GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
  EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
  IPRKASSLTPLAAQKQ

• Sequence length: 556

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

PIP3 activates AKT signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Interleukin-33 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ascending aortic dissection	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION, ASCENDING AORTA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10671636		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	30742053		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22819319		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10671636		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	GWASDB_DG	23817571		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30541599	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21356240		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18774397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19198610, 19852851, 19910030, 19968634, 21150878, 21281963, 21640974, 21682736, 21804549, 22455494, 22574108, 23028483, 23380221, 23439055, 23541324, 24241537, 24568840, 25091434, 25313073, 27130862, 28266165, 28273074, 29247993, 29378629, 29519908, 29694974, 30468398, 30950351, 31066119, 31435003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	19198610, 21150878, 21804549, 24241537, 27472835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19852851, 19910030, 20860503, 21150878, 22574108, 22694930, 23028483, 23541324, 25091434, 27026044, 27699235, 29378629, 29519908, 30373671, 31066119, 31213409, 32277847, 32324168, 34741482, 34964571, 35578178, 38050688, 38128411, 40189906	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	20860503, 21804549, 23028483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	21804549, 23028483, 24388013, 27130862, 29273806, 29785011, 30552067, 30578877, 30929738, 31036433, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	35986608	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	21356240		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24107076	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20465500, 26566691		★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	17603794		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33859633	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18542066, 23497279	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	22574108		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	22574108, 34741482	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33062675, 8659516	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26775708		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34058568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33717076	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28821969		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	38460409	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27890770		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21356240, 28110258, 28121058		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28121058, 33355808	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27223112	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26859134	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10671636		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	29273806, 30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	BEFREE	16222660		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1756497		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25634111		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	19671251		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28860510	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29329638, 31196734		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29068593, 31285364		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24075188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	24075188		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24075188, 35457109	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24075188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis	Craniosynostosis	BEFREE	19671251		★☆☆☆☆ Found in Text Mining only
Cri-du-Chat Syndrome	5p partial monosomy syndrome	BEFREE	8938060		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20014018		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23634226	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	32277847	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	20625511, 36142206	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	33453290	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16118232		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	20625511, 23439055		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35370940	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25793768		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11499563	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11499563		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12476447		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	12058347		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20625511, 23439055		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	31213409	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19860791, 21281963, 28440062		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	27233150		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28121058		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	28121058	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	25409453		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31455667	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	26566691		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	26566691, 30819087		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28821969		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31285364		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	8659516	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	9258666		★☆☆☆☆ Found in Text Mining only
Histiocytoid Cardiomyopathy	Histiocytoid Cardiomyopathy	BEFREE	21585276		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	32324168	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23634226		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23634226	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28067908		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24107076		★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	17495351		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	GWASCAT_DG	25642632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	34879060	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	11493704		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30742053	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33324412	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12752097, 30742053		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	18794051		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27281349		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	27281349	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1913607		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32871771	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26775708		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31659258		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10648414, 11157491, 12368157, 20393505		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28821969		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	39529136	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	GWASCAT_DG	30643255		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10403299, 10616207, 1486562, 15547779, 26775708, 29950152, 31186802, 9258666		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21515798		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19996325		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36947565	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28110258		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28110258		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	31659258	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36824501	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39525518	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	28528200		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29722022		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	32277847	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	35035826, 36310516, 37206297	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27348082		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29954670		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31659258		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31659258	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23634226, 28860510, 29329638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	Pubtator	34373564	Associate	★☆☆☆☆ Found in Text Mining only
Wolf-Hirschhorn Syndrome	Wolf-Hirschhorn Syndrome	BEFREE	11157491, 12058347, 4014316, 8938060		★☆☆☆☆ Found in Text Mining only