Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9166
Gene name	Estrogen receptor binding site associated antigen 9
Gene symbol	EBAG9
Synonyms (NCBI Gene)	EB9PDAF
Chromosome	8
Chromosome location	8q23.2
Summary	This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5`-flanking region of this gene. The encoded protein is a tumor-

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019750	hsa-miR-375	Microarray	20215506
MIRT502564	hsa-miR-193b-3p	PAR-CLIP	24398324
MIRT502563	hsa-miR-193a-3p	PAR-CLIP	24398324
MIRT502562	hsa-miR-892b	PAR-CLIP	24398324
MIRT502561	hsa-miR-4720-5p	PAR-CLIP	24398324
MIRT502560	hsa-miR-4799-3p	PAR-CLIP	24398324
MIRT502558	hsa-miR-5588-5p	PAR-CLIP	24398324
MIRT502559	hsa-miR-3622b-5p	PAR-CLIP	24398324
MIRT502557	hsa-miR-4279	PAR-CLIP	24398324
MIRT502556	hsa-miR-629-3p	PAR-CLIP	24398324
MIRT497601	hsa-miR-4704-5p	PAR-CLIP	22291592
MIRT497600	hsa-miR-4661-5p	PAR-CLIP	22291592
MIRT497599	hsa-miR-4453	PAR-CLIP	22291592
MIRT497598	hsa-miR-4538	PAR-CLIP	22291592
MIRT497597	hsa-miR-6508-5p	PAR-CLIP	22291592
MIRT497596	hsa-miR-8067	PAR-CLIP	22291592
MIRT502564	hsa-miR-193b-3p	PAR-CLIP	24398324
MIRT502563	hsa-miR-193a-3p	PAR-CLIP	24398324
MIRT502562	hsa-miR-892b	PAR-CLIP	24398324
MIRT502561	hsa-miR-4720-5p	PAR-CLIP	24398324
MIRT502560	hsa-miR-4799-3p	PAR-CLIP	24398324
MIRT502558	hsa-miR-5588-5p	PAR-CLIP	24398324
MIRT502559	hsa-miR-3622b-5p	PAR-CLIP	24398324
MIRT502557	hsa-miR-4279	PAR-CLIP	24398324
MIRT502556	hsa-miR-629-3p	PAR-CLIP	24398324
MIRT497601	hsa-miR-4704-5p	PAR-CLIP	22291592
MIRT497600	hsa-miR-4661-5p	PAR-CLIP	22291592
MIRT497599	hsa-miR-4453	PAR-CLIP	22291592
MIRT497598	hsa-miR-4538	PAR-CLIP	22291592
MIRT497597	hsa-miR-6508-5p	PAR-CLIP	22291592
MIRT497596	hsa-miR-8067	PAR-CLIP	22291592
MIRT951290	hsa-miR-1	CLIP-seq
MIRT951291	hsa-miR-1264	CLIP-seq
MIRT951292	hsa-miR-129-5p	CLIP-seq
MIRT951293	hsa-miR-206	CLIP-seq
MIRT951294	hsa-miR-30a	CLIP-seq
MIRT951295	hsa-miR-30b	CLIP-seq
MIRT951296	hsa-miR-30c	CLIP-seq
MIRT951297	hsa-miR-30d	CLIP-seq
MIRT951298	hsa-miR-30e	CLIP-seq
MIRT951299	hsa-miR-3185	CLIP-seq
MIRT951300	hsa-miR-34b	CLIP-seq
MIRT951301	hsa-miR-34c-3p	CLIP-seq
MIRT951302	hsa-miR-3671	CLIP-seq
MIRT951303	hsa-miR-4705	CLIP-seq
MIRT951304	hsa-miR-4709-3p	CLIP-seq
MIRT951305	hsa-miR-513c	CLIP-seq
MIRT951306	hsa-miR-514b-5p	CLIP-seq
MIRT951307	hsa-miR-570	CLIP-seq
MIRT951308	hsa-miR-607	CLIP-seq
MIRT951309	hsa-miR-613	CLIP-seq
MIRT951310	hsa-miR-627	CLIP-seq
MIRT951311	hsa-miR-653	CLIP-seq
MIRT951312	hsa-miR-877	CLIP-seq
MIRT951313	hsa-miR-924	CLIP-seq
MIRT951314	hsa-miR-3122	CLIP-seq
MIRT951300	hsa-miR-34b	CLIP-seq
MIRT951301	hsa-miR-34c-3p	CLIP-seq
MIRT951315	hsa-miR-3689a-3p	CLIP-seq
MIRT951316	hsa-miR-3689c	CLIP-seq
MIRT951317	hsa-miR-3913-5p	CLIP-seq
MIRT951303	hsa-miR-4705	CLIP-seq
MIRT951318	hsa-miR-4761-5p	CLIP-seq
MIRT951299	hsa-miR-3185	CLIP-seq
MIRT951304	hsa-miR-4709-3p	CLIP-seq
MIRT951307	hsa-miR-570	CLIP-seq
MIRT951311	hsa-miR-653	CLIP-seq
MIRT2216656	hsa-miR-3591-3p	CLIP-seq
MIRT2216657	hsa-miR-505	CLIP-seq
MIRT2520504	hsa-miR-186	CLIP-seq
MIRT2520505	hsa-miR-3120-3p	CLIP-seq
MIRT951299	hsa-miR-3185	CLIP-seq
MIRT2520506	hsa-miR-3686	CLIP-seq
MIRT2520507	hsa-miR-3688-3p	CLIP-seq
MIRT2520508	hsa-miR-4261	CLIP-seq
MIRT2520509	hsa-miR-4652-3p	CLIP-seq
MIRT951304	hsa-miR-4709-3p	CLIP-seq
MIRT2520510	hsa-miR-4735-5p	CLIP-seq
MIRT2520511	hsa-miR-545	CLIP-seq
MIRT951307	hsa-miR-570	CLIP-seq
MIRT951311	hsa-miR-653	CLIP-seq
MIRT951291	hsa-miR-1264	CLIP-seq
MIRT951292	hsa-miR-129-5p	CLIP-seq
MIRT2520505	hsa-miR-3120-3p	CLIP-seq
MIRT951299	hsa-miR-3185	CLIP-seq
MIRT2520506	hsa-miR-3686	CLIP-seq
MIRT2520509	hsa-miR-4652-3p	CLIP-seq
MIRT951304	hsa-miR-4709-3p	CLIP-seq
MIRT951305	hsa-miR-513c	CLIP-seq
MIRT951306	hsa-miR-514b-5p	CLIP-seq
MIRT2520511	hsa-miR-545	CLIP-seq
MIRT951307	hsa-miR-570	CLIP-seq
MIRT951311	hsa-miR-653	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001558	Process	Regulation of cell growth	NAS	10426319
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016505	Function	Peptidase activator activity involved in apoptotic process	NAS	10426319
GO:0030141	Component	Secretory granule	IBA
GO:0090717	Process	Adaptive immune memory response involving T cells and B cells	IEA

MIM	HGNC	e!Ensembl
605772	3123	ENSG00000147654

O00559

Protein name

Receptor-binding cancer antigen expressed on SiSo cells (Cancer-associated surface antigen RCAS1) (Estrogen receptor-binding fragment-associated gene 9 protein)

Protein function

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases. {ECO:0000269|PubMed:12054692, ECO:0000269|PubMed:12138241, ECO:0000269|PubMed:

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.

Sequence

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
PDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLAD
REKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Sequence length

213

Interactions

View interactions

	KEGG		Reactome
	Estrogen signaling pathway		Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	11562743, 12044529, 24815841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11992411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12855262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15813909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	19030177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11742495, 12160478, 15164121, 15231680, 15867365, 23563217, 31121525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11742495, 12160478, 9418891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11562743, 11705872, 12044529, 12855262, 16211275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11742495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11466701, 27402224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	15164121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15164121, 31388982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15867365, 19207611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11742495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17604121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	12160478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12888828, 17466050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12888828, 17466050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16907986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15164121, 31388982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24167369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	19207611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16595162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11391627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12855262, 14981953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14981953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11705872, 12160478, 15867365, 23563217, 31121525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17466050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27402224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15867365, 29362448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11562743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11742495, 12044529, 12855262, 15164121, 15867365, 16211275, 19207611, 20214821, 21573489, 24885040, 29362448, 31388982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12054692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	16012715		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	27402224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20214821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11466701, 11705872, 12044529, 12855262, 12888828, 14981953, 15813909, 15867365, 16211275, 16273616, 17922697, 19207611, 21573489, 23563217, 24167369 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24815841		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15164121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16273616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	27402224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12044529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15867365, 29362448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12845666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15867365, 19207611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18688918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14534714, 15254686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24885040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11562743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19122463		★★★★★ ★☆☆☆☆ Found in Text Mining only

EBAG9 (estrogen receptor binding site associated antigen 9)