Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	91653
Gene name	BOC cell adhesion associated, oncogene regulated
Gene symbol	BOC
Synonyms (NCBI Gene)	BoiCDON2
Chromosome	3
Chromosome location	3q13.2
Summary	The protein encoded by this gene is a member of the immunoglobulin/fibronectin type III repeat family. It is a component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells, and promotes myogenic differen

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021881	hsa-miR-128-3p	Microarray	17612493
MIRT030663	hsa-miR-21-5p	Microarray	18591254
MIRT539771	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT539770	hsa-miR-148b-5p	PAR-CLIP	21572407
MIRT539769	hsa-miR-6874-3p	PAR-CLIP	21572407
MIRT539768	hsa-miR-4769-3p	PAR-CLIP	21572407
MIRT539767	hsa-miR-6817-5p	PAR-CLIP	21572407
MIRT539766	hsa-miR-4727-5p	PAR-CLIP	21572407
MIRT539765	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT539764	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT539763	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT539762	hsa-miR-6738-3p	PAR-CLIP	21572407
MIRT539771	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT539770	hsa-miR-148b-5p	PAR-CLIP	21572407
MIRT539769	hsa-miR-6874-3p	PAR-CLIP	21572407
MIRT539768	hsa-miR-4769-3p	PAR-CLIP	21572407
MIRT539767	hsa-miR-6817-5p	PAR-CLIP	21572407
MIRT539766	hsa-miR-4727-5p	PAR-CLIP	21572407
MIRT539765	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT539764	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT539763	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT539762	hsa-miR-6738-3p	PAR-CLIP	21572407
MIRT823544	hsa-miR-3117-3p	CLIP-seq
MIRT823545	hsa-miR-3169	CLIP-seq
MIRT823546	hsa-miR-4759	CLIP-seq
MIRT823547	hsa-miR-515-5p	CLIP-seq
MIRT823548	hsa-miR-654-3p	CLIP-seq
MIRT823549	hsa-miR-95	CLIP-seq
MIRT1943495	hsa-miR-4527	CLIP-seq
MIRT1943496	hsa-miR-642a	CLIP-seq
MIRT2182161	hsa-miR-3163	CLIP-seq
MIRT2182162	hsa-miR-340	CLIP-seq
MIRT2182163	hsa-miR-3925-3p	CLIP-seq
MIRT2182164	hsa-miR-4729	CLIP-seq
MIRT2182165	hsa-miR-766	CLIP-seq
MIRT2485751	hsa-miR-1250	CLIP-seq
MIRT2485752	hsa-miR-1258	CLIP-seq
MIRT2485753	hsa-miR-1262	CLIP-seq
MIRT2485754	hsa-miR-1343	CLIP-seq
MIRT2485755	hsa-miR-1471	CLIP-seq
MIRT2485756	hsa-miR-147b	CLIP-seq
MIRT2485757	hsa-miR-1914	CLIP-seq
MIRT2485758	hsa-miR-2467-3p	CLIP-seq
MIRT2485759	hsa-miR-3074-5p	CLIP-seq
MIRT823544	hsa-miR-3117-3p	CLIP-seq
MIRT2485760	hsa-miR-3124-3p	CLIP-seq
MIRT2485761	hsa-miR-3158-5p	CLIP-seq
MIRT2485762	hsa-miR-3160-5p	CLIP-seq
MIRT823545	hsa-miR-3169	CLIP-seq
MIRT2485763	hsa-miR-3194-5p	CLIP-seq
MIRT2485764	hsa-miR-3678-3p	CLIP-seq
MIRT2485765	hsa-miR-4252	CLIP-seq
MIRT2485766	hsa-miR-4266	CLIP-seq
MIRT2485767	hsa-miR-4294	CLIP-seq
MIRT2485768	hsa-miR-4418	CLIP-seq
MIRT2485769	hsa-miR-4446-5p	CLIP-seq
MIRT2485770	hsa-miR-4449	CLIP-seq
MIRT2485771	hsa-miR-4701-3p	CLIP-seq
MIRT2485772	hsa-miR-4726-3p	CLIP-seq
MIRT2485773	hsa-miR-4746-3p	CLIP-seq
MIRT2485774	hsa-miR-4755-5p	CLIP-seq
MIRT823546	hsa-miR-4759	CLIP-seq
MIRT2485775	hsa-miR-509-3-5p	CLIP-seq
MIRT2485776	hsa-miR-509-5p	CLIP-seq
MIRT823547	hsa-miR-515-5p	CLIP-seq
MIRT1943496	hsa-miR-642a	CLIP-seq
MIRT2485777	hsa-miR-885-3p	CLIP-seq
MIRT823549	hsa-miR-95	CLIP-seq
MIRT2485751	hsa-miR-1250	CLIP-seq
MIRT2485752	hsa-miR-1258	CLIP-seq
MIRT2485753	hsa-miR-1262	CLIP-seq
MIRT2485754	hsa-miR-1343	CLIP-seq
MIRT2485755	hsa-miR-1471	CLIP-seq
MIRT2485756	hsa-miR-147b	CLIP-seq
MIRT2485757	hsa-miR-1914	CLIP-seq
MIRT2485758	hsa-miR-2467-3p	CLIP-seq
MIRT2485759	hsa-miR-3074-5p	CLIP-seq
MIRT2485760	hsa-miR-3124-3p	CLIP-seq
MIRT2485761	hsa-miR-3158-5p	CLIP-seq
MIRT2485762	hsa-miR-3160-5p	CLIP-seq
MIRT2485763	hsa-miR-3194-5p	CLIP-seq
MIRT2485764	hsa-miR-3678-3p	CLIP-seq
MIRT2485765	hsa-miR-4252	CLIP-seq
MIRT2485766	hsa-miR-4266	CLIP-seq
MIRT2485767	hsa-miR-4294	CLIP-seq
MIRT2485768	hsa-miR-4418	CLIP-seq
MIRT2485770	hsa-miR-4449	CLIP-seq
MIRT2485771	hsa-miR-4701-3p	CLIP-seq
MIRT2485772	hsa-miR-4726-3p	CLIP-seq
MIRT2485773	hsa-miR-4746-3p	CLIP-seq
MIRT2485775	hsa-miR-509-3-5p	CLIP-seq
MIRT2485776	hsa-miR-509-5p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11782431, 20519495, 21802063
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0007411	Process	Axon guidance	IBA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IBA
GO:0044295	Component	Axonal growth cone	IEA
GO:0045663	Process	Positive regulation of myoblast differentiation	ISS
GO:0098609	Process	Cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
608708	17173	ENSG00000144857

Q9BWV1

Protein name

Brother of CDO (Protein BOC)

Protein function

Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells.

PDB

3N1G , 3N1M , 3N1P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	35 → 109		Domain
PF00047	ig	134 → 213	Immunoglobulin domain	Domain
PF13927	Ig_3	230 → 303		Domain
PF07679	I-set	323 → 408	Immunoglobulin I-set domain	Domain
PF16625	ISET-FN3_linker	409 → 473		Disordered
PF00041	fn3	477 → 561	Fibronectin type III domain	Domain
PF00041	fn3	607 → 693	Fibronectin type III domain	Domain
PF00041	fn3	716 → 802	Fibronectin type III domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in skeletal muscle, heart, thymus, kidney and small intestine. Detected at lower levels in brain, placenta, lung and colon mucosa. {ECO:0000269|PubMed:11782431}.

Sequence

MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLD
PGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDH
GRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIP
PSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITF
TDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHL
QPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERP
VGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPS
CPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGEL
QQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQ
RQEQPAAVGQSGVRRAPDSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDWC
PQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI

Sequence length

1114

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway Axon guidance		Myogenesis Activation of SMO

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HOLOPROSENCEPHALY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Holoprosencephaly sequence	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24118703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	28915250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	31152979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASDB_DG	23829686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27990835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31352923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Holoprosencephaly	Holoprosencephaly	BEFREE	28677295		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukopenia	Leukopenia	BEFREE	23064222, 24118703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	30857637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27990835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25263791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	23064222, 24118703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	27990835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33892811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33811245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BOC (BOC cell adhesion associated, oncogene regulated)