Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9162
Gene name	Diacylglycerol kinase iota
Gene symbol	DGKI
Synonyms (NCBI Gene)	DGK-IOTA
Chromosome	7
Chromosome location	7q33
Summary	This gene is a member of the type IV diacylglycerol kinase subfamily. Diacylglycerol kinases regulate the intracellular concentration of diacylglycerol through its phosphorylation, producing phosphatidic acid. The specific role of the enzyme encoded by

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028926	hsa-miR-26b-5p	Microarray	19088304
MIRT716230	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT716229	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT716228	hsa-miR-4635	HITS-CLIP	19536157
MIRT716227	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT716226	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT716225	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT716230	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT716229	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT716228	hsa-miR-4635	HITS-CLIP	19536157
MIRT716227	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT716226	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT716225	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT934220	hsa-miR-1184	CLIP-seq
MIRT934221	hsa-miR-1205	CLIP-seq
MIRT934222	hsa-miR-1286	CLIP-seq
MIRT934223	hsa-miR-140-5p	CLIP-seq
MIRT934224	hsa-miR-181a	CLIP-seq
MIRT934225	hsa-miR-181b	CLIP-seq
MIRT934226	hsa-miR-181c	CLIP-seq
MIRT934227	hsa-miR-181d	CLIP-seq
MIRT934228	hsa-miR-19a	CLIP-seq
MIRT934229	hsa-miR-19b	CLIP-seq
MIRT934230	hsa-miR-3154	CLIP-seq
MIRT934231	hsa-miR-3158-5p	CLIP-seq
MIRT934232	hsa-miR-3691-3p	CLIP-seq
MIRT934233	hsa-miR-4262	CLIP-seq
MIRT934234	hsa-miR-4275	CLIP-seq
MIRT934235	hsa-miR-4436a	CLIP-seq
MIRT934236	hsa-miR-4694-3p	CLIP-seq
MIRT934237	hsa-miR-4722-5p	CLIP-seq
MIRT934238	hsa-miR-4795-5p	CLIP-seq
MIRT934239	hsa-miR-543	CLIP-seq
MIRT934240	hsa-miR-544	CLIP-seq
MIRT934241	hsa-miR-582-5p	CLIP-seq
MIRT1976571	hsa-miR-2861	CLIP-seq
MIRT934232	hsa-miR-3691-3p	CLIP-seq
MIRT934234	hsa-miR-4275	CLIP-seq
MIRT1976572	hsa-miR-4757-5p	CLIP-seq
MIRT1976573	hsa-miR-500a	CLIP-seq
MIRT2515667	hsa-let-7a	CLIP-seq
MIRT2515668	hsa-let-7b	CLIP-seq
MIRT2515669	hsa-let-7c	CLIP-seq
MIRT2515670	hsa-let-7d	CLIP-seq
MIRT2515671	hsa-let-7e	CLIP-seq
MIRT2515672	hsa-let-7f	CLIP-seq
MIRT2515673	hsa-let-7g	CLIP-seq
MIRT2515674	hsa-let-7i	CLIP-seq
MIRT2515675	hsa-miR-149	CLIP-seq
MIRT2515676	hsa-miR-150	CLIP-seq
MIRT2515677	hsa-miR-202	CLIP-seq
MIRT2515678	hsa-miR-2116	CLIP-seq
MIRT2515679	hsa-miR-3064-5p	CLIP-seq
MIRT2515680	hsa-miR-3159	CLIP-seq
MIRT2515681	hsa-miR-3183	CLIP-seq
MIRT2515682	hsa-miR-323-5p	CLIP-seq
MIRT2515683	hsa-miR-331-3p	CLIP-seq
MIRT2515684	hsa-miR-375	CLIP-seq
MIRT2515685	hsa-miR-3921	CLIP-seq
MIRT2515686	hsa-miR-3935	CLIP-seq
MIRT2515687	hsa-miR-409-5p	CLIP-seq
MIRT2515688	hsa-miR-4273	CLIP-seq
MIRT2515689	hsa-miR-4292	CLIP-seq
MIRT2515690	hsa-miR-4458	CLIP-seq
MIRT2515691	hsa-miR-4500	CLIP-seq
MIRT2515692	hsa-miR-4649-3p	CLIP-seq
MIRT2515693	hsa-miR-4653-5p	CLIP-seq
MIRT2515694	hsa-miR-4677-5p	CLIP-seq
MIRT2515695	hsa-miR-4713-5p	CLIP-seq
MIRT2515696	hsa-miR-4715-3p	CLIP-seq
MIRT2515697	hsa-miR-4723-3p	CLIP-seq
MIRT2515698	hsa-miR-4762-3p	CLIP-seq
MIRT2515699	hsa-miR-4777-3p	CLIP-seq
MIRT2515700	hsa-miR-4794	CLIP-seq
MIRT2515701	hsa-miR-485-3p	CLIP-seq
MIRT2515702	hsa-miR-532-3p	CLIP-seq
MIRT2515703	hsa-miR-635	CLIP-seq
MIRT2515704	hsa-miR-876-3p	CLIP-seq
MIRT2515705	hsa-miR-890	CLIP-seq
MIRT2515706	hsa-miR-98	CLIP-seq
MIRT2515675	hsa-miR-149	CLIP-seq
MIRT2515679	hsa-miR-3064-5p	CLIP-seq
MIRT2515682	hsa-miR-323-5p	CLIP-seq
MIRT2515686	hsa-miR-3935	CLIP-seq
MIRT2515700	hsa-miR-4794	CLIP-seq
MIRT2515704	hsa-miR-876-3p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IBA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IDA	9830018
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	IEA
GO:0004143	Function	ATP-dependent diacylglycerol kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	17986458
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	9830018
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	9830018
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006654	Process	Phosphatidic acid biosynthetic process	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032991	Component	Protein-containing complex	IDA	21119615
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IDA	21119615
GO:0045202	Component	Synapse	IDA	21119615
GO:0045202	Component	Synapse	IEA
GO:0046339	Process	Diacylglycerol metabolic process	IBA
GO:0046486	Process	Glycerolipid metabolic process	IEA
GO:0046834	Process	Lipid phosphorylation	IDA	9830018
GO:0046834	Process	Lipid phosphorylation	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IBA

MIM	HGNC	e!Ensembl
604072	2855	ENSG00000157680

O75912

Protein name

Diacylglycerol kinase iota (DAG kinase iota) (DGK-iota) (EC 2.7.1.107)

Protein function

Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids (PubMed:23949095, PubMed:9830018). Thereby, acts as a central switch between the sig

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	251 → 310	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00781	DAGK_cat	376 → 497	Diacylglycerol kinase catalytic domain	Family
PF00609	DAGK_acc	526 → 683	Diacylglycerol kinase accessory domain	Family
PF00023	Ank	994 → 1026	Ankyrin repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in brain and retina (PubMed:9830018). In brain, highly expressed in hippocampus, caudate nucleus, occipital pole, cerebral cortex, and cerebellum (PubMed:9830018). Also detected in kidney (PubMed:15894621). {ECO:

Sequence

MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAG
EEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEE
KLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLW
LETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGG
SRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCF
MLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENK
GRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDE
PVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVT
LEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQEL
KFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGER
LHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSV
PDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDC
DLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGM
IAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHC
SLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGAS
LRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV

Sequence length

1065

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Metabolic pathways Phosphatidylinositol signaling system Phospholipase D signaling pathway Choline metabolism in cancer		Effects of PIP2 hydrolysis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune disease	Pubtator	31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19065143	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	21203819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	30941163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25233099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25233099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25233099		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	28092667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25233099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10706894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	19065143	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 28540026, 28991256, 29483656, 30285260, 31268507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	36059514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DGKI (diacylglycerol kinase iota)