Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	91607
Gene name	Schlafen family member 11
Gene symbol	SLFN11
Synonyms (NCBI Gene)	SLFN8/9
Chromosome	17
Chromosome location	17q12

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046706	hsa-miR-222-3p	CLASH	23622248
MIRT045763	hsa-miR-125a-5p	CLASH	23622248
MIRT563996	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT563995	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT563994	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT563993	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT563992	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT563991	hsa-miR-6077	PAR-CLIP	20371350
MIRT563990	hsa-miR-6079	PAR-CLIP	20371350
MIRT563989	hsa-miR-3611	PAR-CLIP	20371350
MIRT563988	hsa-miR-3646	PAR-CLIP	20371350
MIRT563987	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT563986	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT563985	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT563984	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT563983	hsa-miR-577	PAR-CLIP	20371350
MIRT563982	hsa-miR-4496	PAR-CLIP	20371350
MIRT563981	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT563980	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT563979	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT398845	hsa-miR-4261	PAR-CLIP	20371350
MIRT563996	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT563995	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT563994	hsa-miR-4717-5p	PAR-CLIP	20371350
MIRT563993	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT563992	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT563991	hsa-miR-6077	PAR-CLIP	20371350
MIRT563990	hsa-miR-6079	PAR-CLIP	20371350
MIRT563989	hsa-miR-3611	PAR-CLIP	20371350
MIRT563988	hsa-miR-3646	PAR-CLIP	20371350
MIRT563987	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT563986	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT563985	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT563984	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT563983	hsa-miR-577	PAR-CLIP	20371350
MIRT563982	hsa-miR-4496	PAR-CLIP	20371350
MIRT563981	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT563980	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT563979	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT398845	hsa-miR-4261	PAR-CLIP	20371350
MIRT1369492	hsa-miR-1266	CLIP-seq
MIRT1369493	hsa-miR-2117	CLIP-seq
MIRT1369494	hsa-miR-3145-5p	CLIP-seq
MIRT1369495	hsa-miR-3155	CLIP-seq
MIRT1369496	hsa-miR-3155b	CLIP-seq
MIRT1369497	hsa-miR-3664-3p	CLIP-seq
MIRT1369498	hsa-miR-4273	CLIP-seq
MIRT1369499	hsa-miR-4518	CLIP-seq
MIRT1369500	hsa-miR-4685-5p	CLIP-seq
MIRT1369501	hsa-miR-4768-3p	CLIP-seq
MIRT1369502	hsa-miR-484	CLIP-seq
MIRT1369503	hsa-miR-495	CLIP-seq
MIRT1369504	hsa-miR-548an	CLIP-seq
MIRT1369505	hsa-miR-1294	CLIP-seq
MIRT1369506	hsa-miR-2467-5p	CLIP-seq
MIRT1369507	hsa-miR-3188	CLIP-seq
MIRT1369508	hsa-miR-3975	CLIP-seq
MIRT1369509	hsa-miR-4279	CLIP-seq
MIRT1369510	hsa-miR-4316	CLIP-seq
MIRT1369511	hsa-miR-4328	CLIP-seq
MIRT1369512	hsa-miR-4530	CLIP-seq
MIRT1369501	hsa-miR-4768-3p	CLIP-seq
MIRT1369513	hsa-miR-485-5p	CLIP-seq
MIRT1369514	hsa-miR-503	CLIP-seq
MIRT1369504	hsa-miR-548an	CLIP-seq
MIRT2627319	hsa-miR-1179	CLIP-seq
MIRT2627320	hsa-miR-1206	CLIP-seq
MIRT2627321	hsa-miR-1228	CLIP-seq
MIRT2627322	hsa-miR-1229	CLIP-seq
MIRT2627323	hsa-miR-1253	CLIP-seq
MIRT1369492	hsa-miR-1266	CLIP-seq
MIRT2627324	hsa-miR-128	CLIP-seq
MIRT2627325	hsa-miR-1285	CLIP-seq
MIRT2627326	hsa-miR-133a	CLIP-seq
MIRT2627327	hsa-miR-133b	CLIP-seq
MIRT2627328	hsa-miR-146a	CLIP-seq
MIRT2627329	hsa-miR-146b-5p	CLIP-seq
MIRT2627330	hsa-miR-2053	CLIP-seq
MIRT1369493	hsa-miR-2117	CLIP-seq
MIRT2627331	hsa-miR-27a	CLIP-seq
MIRT2627332	hsa-miR-27b	CLIP-seq
MIRT2627333	hsa-miR-302f	CLIP-seq
MIRT1369495	hsa-miR-3155	CLIP-seq
MIRT1369496	hsa-miR-3155b	CLIP-seq
MIRT2627334	hsa-miR-3159	CLIP-seq
MIRT2627335	hsa-miR-3187-5p	CLIP-seq
MIRT2627336	hsa-miR-329	CLIP-seq
MIRT2627337	hsa-miR-33a	CLIP-seq
MIRT2627338	hsa-miR-33b	CLIP-seq
MIRT2627339	hsa-miR-342-3p	CLIP-seq
MIRT2627340	hsa-miR-3591-3p	CLIP-seq
MIRT2627341	hsa-miR-362-3p	CLIP-seq
MIRT1369497	hsa-miR-3664-3p	CLIP-seq
MIRT2627342	hsa-miR-378g	CLIP-seq
MIRT2627343	hsa-miR-3941	CLIP-seq
MIRT2627344	hsa-miR-4251	CLIP-seq
MIRT1369498	hsa-miR-4273	CLIP-seq
MIRT2627345	hsa-miR-4302	CLIP-seq
MIRT2627346	hsa-miR-4303	CLIP-seq
MIRT2627347	hsa-miR-4329	CLIP-seq
MIRT2627348	hsa-miR-4436b-5p	CLIP-seq
MIRT2627349	hsa-miR-4470	CLIP-seq
MIRT2627350	hsa-miR-4486	CLIP-seq
MIRT1369499	hsa-miR-4518	CLIP-seq
MIRT2627351	hsa-miR-4527	CLIP-seq
MIRT2627352	hsa-miR-4640-5p	CLIP-seq
MIRT2627353	hsa-miR-4652-3p	CLIP-seq
MIRT1369500	hsa-miR-4685-5p	CLIP-seq
MIRT2627354	hsa-miR-4726-5p	CLIP-seq
MIRT2627355	hsa-miR-4766-5p	CLIP-seq
MIRT2627356	hsa-miR-4786-5p	CLIP-seq
MIRT1369502	hsa-miR-484	CLIP-seq
MIRT2627357	hsa-miR-487b	CLIP-seq
MIRT2627358	hsa-miR-494	CLIP-seq
MIRT1369503	hsa-miR-495	CLIP-seq
MIRT2627359	hsa-miR-514	CLIP-seq
MIRT2627360	hsa-miR-514b-3p	CLIP-seq
MIRT2627361	hsa-miR-516b	CLIP-seq
MIRT2627362	hsa-miR-579	CLIP-seq
MIRT2627363	hsa-miR-589	CLIP-seq
MIRT2627364	hsa-miR-590-3p	CLIP-seq
MIRT2627365	hsa-miR-603	CLIP-seq
MIRT2627366	hsa-miR-612	CLIP-seq
MIRT2627367	hsa-miR-622	CLIP-seq
MIRT2627368	hsa-miR-889	CLIP-seq
MIRT2627320	hsa-miR-1206	CLIP-seq
MIRT2627321	hsa-miR-1228	CLIP-seq
MIRT2627326	hsa-miR-133a	CLIP-seq
MIRT2627327	hsa-miR-133b	CLIP-seq
MIRT2627336	hsa-miR-329	CLIP-seq
MIRT2627341	hsa-miR-362-3p	CLIP-seq
MIRT2627343	hsa-miR-3941	CLIP-seq
MIRT2627348	hsa-miR-4436b-5p	CLIP-seq
MIRT2627349	hsa-miR-4470	CLIP-seq
MIRT1369500	hsa-miR-4685-5p	CLIP-seq
MIRT2627355	hsa-miR-4766-5p	CLIP-seq
MIRT2627362	hsa-miR-579	CLIP-seq
MIRT2627365	hsa-miR-603	CLIP-seq
MIRT2627368	hsa-miR-889	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IBA
GO:0000049	Function	TRNA binding	IDA	23000900
GO:0000049	Function	TRNA binding	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004386	Function	Helicase activity	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	29395061
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	22927417, 29395061
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IDA	29395061
GO:0006974	Process	DNA damage response	IDA	29395061
GO:0006974	Process	DNA damage response	IEA
GO:0008156	Process	Negative regulation of DNA replication	IDA	29395061
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	29395061
GO:0043111	Process	Replication fork arrest	IDA	29395061
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	23000900
GO:0090734	Component	Site of DNA damage	IDA	29395061
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IMP	22927417

MIM	HGNC	e!Ensembl
614953	26633	ENSG00000172716

Q7Z7L1

Protein name

Schlafen family member 11 (EC 3.1.-.-)

Protein function

Inhibitor of DNA replication that promotes cell death in response to DNA damage (PubMed:22927417, PubMed:26658330, PubMed:29395061). Acts as a guardian of the genome by killing cells with defective replication (PubMed:29395061). Persistently blo

PDB

7ZEL , 7ZEP , 7ZES , 9ERD , 9ERE , 9ERF , 9GMW , 9GMX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04326	AlbA_2	209 → 331	Putative DNA-binding domain	Domain
PF09848	DUF2075	592 → 714	Uncharacterized conserved protein (DUF2075)	Family

Tissue specificity

TISSUE SPECIFICITY: Exhibits a wider expression range in ovarian and colon adenocarcinoma than in their corresponding healthy tissues. {ECO:0000269|PubMed:22927417}.

Sequence

MEANQCPLVVEPSYPDLVINVGEVTLGEENRKKLQKIQRDQEKERVMRAACALLNSGGGV
IRMAKKVEHPVEMGLDLEQSLRELIQSSDLQAFFETKQQGRCFYIFVKSWSSGPFPEDRS
VKPRLCSLSSSLYRRSETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNS
DPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQEYVKRTIPEYVPAFAN
TGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIV
NVLKRGELYGYACMIRVNPFCCAVFSEAPNSWIVEDKYVCSLTTEKWVGMMTDTDPDLLQ
LSEDFECQLSLSSGPPLSRPVYSKKGLEHKKELQQLLFSVPPGYLRYTPESLWRDLISEH
RGLEELINKQMQPFFRGILIFSRSWAVDLNLQEKPGVICDALLIAQNSTPILYTILREQD
AEGQDYCTRTAFTLKQKLVNMGGYTGKVCVRAKVLCLSPESSAEALEAAVSPMDYPASYS
LAGTQHMEALLQSLVIVLLGFRSLLSDQLGCEVLNLLTAQQYEIFSRSLRKNRELFVHGL
PGSGKTIMAMKIMEKIRNVFHCEAHRILYVCENQPLRNFISDRNICRAETRKTFLRENFE
HIQHIVIDEAQNFRTEDGDWYGKAKSITRRAKGGPGILWIFLDYFQTSHLDCSGLPPLSD
QYPREELTRIVRNADPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWSQGVQGTLRIK
KYLTVEQIMTCVADTCRRFFDRGYSPKDVAVLVSTAKEVEHYKYELLKAMRKKRVVQLSD
ACDMLGDHIVLDSVRRFSGLERSIVFGIHPRTADPAILPNVLICLASRAKQHLYIFPWGG
H

Sequence length

901

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Moyamoya angiopathy	Likely pathogenic	rs1203408796	RCV004704505	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	31262879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31222709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25779942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32474729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	34893686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32107283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25089570, 26525741, 28403629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26525741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33218331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33218331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25779942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	32735670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31118262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31118262, 34903607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36382088	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31118262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	34085099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25779942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25779942, 33863777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31222709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25089570, 26625211, 27440269, 28969705, 29391350, 31092045, 31128155, 31222709, 31395656, 31682620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36273330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25733708, 26525741, 29906251, 30753225, 31128155, 31682620, 31762822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25733708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22927417, 26625211, 34549724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	31682620		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	31682620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32127465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25733708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25779942, 33256675, 37599787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27440269, 28212573, 29906251, 31148500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28196592, 28212573, 32586373, 34893686, 35440668, 35511434, 40649874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31490091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33785877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36090985	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32075943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34808009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLFN11 (schlafen family member 11)