Gene Gene information from NCBI Gene database.
Entrez ID 916
Gene name CD3 epsilon subunit of T-cell receptor complex
Gene symbol CD3E
Synonyms (NCBI Gene)
CD3epsilonIMD18T3ETCRE
Chromosome 11
Chromosome location 11q23.3
Summary The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs121918659 G>A Pathogenic Coding sequence variant, stop gained
rs140639753 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs201543770 G>A,T Likely-pathogenic Splice donor variant
rs483352928 T>C,G Pathogenic Splice donor variant
rs483352929 CC>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
53
miRTarBase ID miRNA Experiments Reference
MIRT488524 hsa-miR-4781-5p PAR-CLIP 23592263
MIRT488525 hsa-miR-4779 PAR-CLIP 23592263
MIRT488523 hsa-miR-3155a PAR-CLIP 23592263
MIRT488522 hsa-miR-3155b PAR-CLIP 23592263
MIRT488521 hsa-miR-484 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
87
GO ID Ontology Definition Evidence Reference
GO:0001772 Component Immunological synapse IEA
GO:0001954 Process Positive regulation of cell-matrix adhesion IEA
GO:0001954 Process Positive regulation of cell-matrix adhesion ISS 12652296
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 29789755, 30976362
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186830 1674 ENSG00000198851
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P07766
Protein name T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)
Protein function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell
PDB 1A81 , 1SY6 , 1XIW , 2ROL , 5QU2 , 6JXR , 7FJD , 7FJE , 7FJF , 7PHR , 8ES7 , 8ES8 , 8ES9 , 8F0L , 8JC0 , 8JCB , 8TW4 , 8TW6 , 8VY4 , 8WXE , 8WY0 , 8WYI , 8YC0 , 9BBC , 9C3E , 9CI8 , 9CIA , 9CQ4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16681 Ig_5 36 127 Domain
PF02189 ITAM 185 204 Immunoreceptor tyrosine-based activation motif Motif
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDV
MSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
Sequence length 207
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Chagas disease
Measles
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Immunodeficiency 18 Likely pathogenic; Pathogenic rs908640922, rs1419311230, rs483352928, rs121918659, rs2496834883, rs2496836773, rs1948142385, rs2496837183, rs147435007, rs1213870519, rs2496837031, rs201543770, rs1249197356, rs201840561 RCV001976053
RCV003778929
RCV000087024
RCV000087025
RCV003583244
View all (11 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Immunodeficiency 18, severe combined immunodeficiency variant Pathogenic rs483352929 RCV000087026
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Severe combined immunodeficiency disease Likely pathogenic; Pathogenic rs1419311230 RCV003155755
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ARTHRITIS, RHEUMATOID CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CD3E-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma LHGDN 17668204
★☆☆☆☆
Found in Text Mining only
Anemia Aplastic Aplastic anemia Pubtator 22401598 Stimulate
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia HPO_DG
★☆☆☆☆
Found in Text Mining only
Antibody Deficiency Syndrome Antibody Deficiency Syndrome CTD_human_DG 8490660
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 28654700
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 1671848, 22723555, 23751612
★☆☆☆☆
Found in Text Mining only
Bare Lymphocyte Syndrome Bare Lymphocyte Syndrome CTD_human_DG 15546002
★☆☆☆☆
Found in Text Mining only
Bone Neoplasms Bone neoplasm Pubtator 33095470 Inhibit
★☆☆☆☆
Found in Text Mining only
Brain Injuries Brain injuries Pubtator 24610929 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 33968066, 34867821 Associate
★☆☆☆☆
Found in Text Mining only