Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	916
Gene name	CD3 epsilon subunit of T-cell receptor complex
Gene symbol	CD3E
Synonyms (NCBI Gene)	CD3epsilonIMD18T3ETCRE
Chromosome	11
Chromosome location	11q23.3
Summary	The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918659	G>A	Pathogenic	Coding sequence variant, stop gained
rs140639753	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs201543770	G>A,T	Likely-pathogenic	Splice donor variant
rs483352928	T>C,G	Pathogenic	Splice donor variant
rs483352929	CC>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT488524	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT488525	hsa-miR-4779	PAR-CLIP	23592263
MIRT488523	hsa-miR-3155a	PAR-CLIP	23592263
MIRT488522	hsa-miR-3155b	PAR-CLIP	23592263
MIRT488521	hsa-miR-484	PAR-CLIP	23592263
MIRT488520	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488519	hsa-miR-4510	PAR-CLIP	23592263
MIRT488518	hsa-miR-6127	PAR-CLIP	23592263
MIRT488517	hsa-miR-6129	PAR-CLIP	23592263
MIRT488516	hsa-miR-6130	PAR-CLIP	23592263
MIRT488515	hsa-miR-6133	PAR-CLIP	23592263
MIRT488514	hsa-miR-4772-5p	PAR-CLIP	23592263
MIRT488513	hsa-miR-3135b	PAR-CLIP	23592263
MIRT488512	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488510	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488511	hsa-miR-3652	PAR-CLIP	23592263
MIRT488509	hsa-miR-4430	PAR-CLIP	23592263
MIRT488508	hsa-miR-6090	PAR-CLIP	23592263
MIRT488507	hsa-miR-4525	PAR-CLIP	23592263
MIRT488505	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT488524	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT488525	hsa-miR-4779	PAR-CLIP	23592263
MIRT488523	hsa-miR-3155a	PAR-CLIP	23592263
MIRT488522	hsa-miR-3155b	PAR-CLIP	23592263
MIRT488521	hsa-miR-484	PAR-CLIP	23592263
MIRT488520	hsa-miR-4419a	PAR-CLIP	23592263
MIRT488519	hsa-miR-4510	PAR-CLIP	23592263
MIRT488518	hsa-miR-6127	PAR-CLIP	23592263
MIRT488517	hsa-miR-6129	PAR-CLIP	23592263
MIRT488516	hsa-miR-6130	PAR-CLIP	23592263
MIRT488515	hsa-miR-6133	PAR-CLIP	23592263
MIRT488514	hsa-miR-4772-5p	PAR-CLIP	23592263
MIRT488513	hsa-miR-3135b	PAR-CLIP	23592263
MIRT488512	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT488510	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT488511	hsa-miR-3652	PAR-CLIP	23592263
MIRT488509	hsa-miR-4430	PAR-CLIP	23592263
MIRT488508	hsa-miR-6090	PAR-CLIP	23592263
MIRT488507	hsa-miR-4525	PAR-CLIP	23592263
MIRT488505	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT875237	hsa-miR-3191	CLIP-seq
MIRT875238	hsa-miR-4446-3p	CLIP-seq
MIRT875239	hsa-miR-4721	CLIP-seq
MIRT1959503	hsa-miR-185	CLIP-seq
MIRT1959504	hsa-miR-3150b-3p	CLIP-seq
MIRT1959505	hsa-miR-3199	CLIP-seq
MIRT1959506	hsa-miR-4306	CLIP-seq
MIRT1959507	hsa-miR-4515	CLIP-seq
MIRT1959508	hsa-miR-4644	CLIP-seq
MIRT1959509	hsa-miR-4652-5p	CLIP-seq
MIRT1959510	hsa-miR-4716-3p	CLIP-seq
MIRT1959511	hsa-miR-4784	CLIP-seq
MIRT1959512	hsa-miR-769-5p	CLIP-seq

Show/Hide all (87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS	12652296
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	29789755, 30976362
GO:0002376	Process	Immune system process	IEA
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0002870	Process	T cell anergy	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IC	9485181
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	38614099
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	7761456, 9485181, 9698567, 11855827, 17617578, 18424730, 18644376, 18955169, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IDA	38614099
GO:0005886	Component	Plasma membrane	IDA	11390434, 31461748
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	9485181, 30976362
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IC	9485181
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	12110186
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	8530500
GO:0007172	Process	Signal complex assembly	TAS	8490660
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8530500
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	11390434, 17213291
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0010629	Process	Negative regulation of gene expression	IMP	23817958
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IEA
GO:0017124	Function	SH3 domain binding	IPI	12110186
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019901	Function	Protein kinase binding	NAS	12110186
GO:0021549	Process	Cerebellum development	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	9886373
GO:0031295	Process	T cell costimulation	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	IEA
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	ISS	12652296
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042101	Component	T cell receptor complex	IDA	8176201
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	12110186
GO:0042105	Component	Alpha-beta T cell receptor complex	IBA
GO:0042105	Component	Alpha-beta T cell receptor complex	IDA	9485181
GO:0042105	Component	Alpha-beta T cell receptor complex	IEA
GO:0042105	Component	Alpha-beta T cell receptor complex	IPI	31461748
GO:0042105	Component	Alpha-beta T cell receptor complex	ISS
GO:0042106	Component	Gamma-delta T cell receptor complex	NAS	16418397
GO:0042110	Process	T cell activation	IEA
GO:0042110	Process	T cell activation	NAS	12110186
GO:0042608	Function	T cell receptor binding	NAS	11186279
GO:0042802	Function	Identical protein binding	IDA	14967045
GO:0042981	Process	Regulation of apoptotic process	NAS	12567487
GO:0043197	Component	Dendritic spine	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11368773
GO:0044297	Component	Cell body	IEA
GO:0045059	Process	Positive thymic T cell selection	IBA
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0046629	Process	Gamma-delta T cell activation	NAS	30976362
GO:0046631	Process	Alpha-beta T cell activation	NAS	29789755
GO:0046649	Process	Lymphocyte activation	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	11368773, 38614099
GO:0050852	Process	T cell receptor signaling pathway	IDA	38614099
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	NAS	29789755, 30976362
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0065003	Process	Protein-containing complex assembly	NAS	9886373
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IEA

MIM	HGNC	e!Ensembl
186830	1674	ENSG00000198851

P07766

Protein name

T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)

Protein function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell

PDB

1A81 , 1SY6 , 1XIW , 2ROL , 5QU2 , 6JXR , 7FJD , 7FJE , 7FJF , 7PHR , 8ES7 , 8ES8 , 8ES9 , 8F0L , 8JC0 , 8JCB , 8TW4 , 8TW6 , 8VY4 , 8WXE , 8WY0 , 8WYI , 8YC0 , 9BBC , 9C3E , 9CI8 , 9CIA , 9CQ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16681	Ig_5	36 → 127		Domain
PF02189	ITAM	185 → 204	Immunoreceptor tyrosine-based activation motif	Motif

Sequence

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Chagas disease Measles Human T-cell leukemia virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Primary immunodeficiency		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules PD-1 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 18	Likely pathogenic; Pathogenic	rs908640922, rs1419311230, rs483352928, rs121918659, rs2496834883, rs2496836773, rs1948142385, rs2496837183, rs147435007, rs1213870519, rs2496837031, rs201543770, rs1249197356, rs201840561	RCV001976053 RCV003778929 RCV000087024 RCV000087025 RCV003583244 View all (11 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Immunodeficiency 18, severe combined immunodeficiency variant	Pathogenic	rs483352929	RCV000087026	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Severe combined immunodeficiency disease	Likely pathogenic; Pathogenic	rs1419311230	RCV003155755	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD3E-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE COMBINED IMMUNODEFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (85)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	17668204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	22401598	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Antibody Deficiency Syndrome	Antibody Deficiency Syndrome	CTD_human_DG	8490660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28654700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	1671848, 22723555, 23751612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	CTD_human_DG	15546002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	33095470	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	24610929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33968066, 34867821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	30564228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21980389, 22664550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34218795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21980389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	9616229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12851869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34975867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27745778, 29030662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27745778, 29030662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	1671006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1671006, 30274071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	11877434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24330827	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34124265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29805749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29805749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GATA2 Deficiency	Gata2 deficiency	Pubtator	11971211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11313428, 29507075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35090306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 18	Immunodeficiency	CLINVAR_DG	15546002, 8490660		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
IMMUNODEFICIENCY 18	Immunodeficiency	GENOMICS_ENGLAND_DG	7937778		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
IMMUNODEFICIENCY 18	Immunodeficiency	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
IMMUNODEFICIENCY 18, SCID VARIANT	IMMUNODEFICIENCY, SCID VARIANT	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 18, SEVERE COMBINED IMMUNODEFICIENCY VARIANT	IMMUNODEFICIENCY, SCID VARIANT	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency due to Defect in CD3-Epsilon	Immunodeficiency	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21203507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	CTD_human_DG	8490660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17668204	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28400152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12890821	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18815285, 21274672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26230248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29761078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30924846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29805749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	9616229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23041545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10848781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37274867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30038626, 31615814, 8050820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	CTD_human_DG	15546002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	22723555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14715568	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	9616229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34633990, 37841886, 9616229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	26358743	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	21264308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	3100631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23041545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36655999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16308105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	33095470	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	31842801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	CLINGEN_DG	1370449, 15546002, 1828760, 24515816, 7937778, 8490660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	CTD_human_DG	15546002		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	15546002, 30564228, 32265901, 33040328, 35303369	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	16264327, 22723555		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	7937778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29805749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21264308	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33134377, 34091115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta	Severe combined immunodeficiency disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12851869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	37501789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33204728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33901225, 35090306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19369244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD3E (CD3 epsilon subunit of T-cell receptor complex)