Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9154
Gene name	Solute carrier family 28 member 1
Gene symbol	SLC28A1
Synonyms (NCBI Gene)	CNT1HCNT1URCTU
Chromosome	15
Chromosome location	15q25.3

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2242047	C>T	Affects	Coding sequence variant, missense variant, downstream transcript variant, genic downstream transcript variant, intron variant, non coding transcript variant
rs45584739	T>C	Affects	Intron variant, missense variant, genic downstream transcript variant, coding sequence variant
rs149246522	G>A	Affects	Missense variant, genic downstream transcript variant, coding sequence variant, intron variant

178

Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030057	hsa-miR-26b-5p	Microarray	19088304
MIRT633665	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT633664	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT633663	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT633662	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT633661	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT633660	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT633659	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT633658	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT633657	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT633656	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT633655	hsa-miR-6131	HITS-CLIP	23824327
MIRT633654	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT633653	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT633652	hsa-miR-640	HITS-CLIP	23824327
MIRT633651	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT633650	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT563797	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT563796	hsa-miR-490-5p	PAR-CLIP	20371350
MIRT563795	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT563794	hsa-miR-107	PAR-CLIP	20371350
MIRT563793	hsa-miR-1193	PAR-CLIP	20371350
MIRT563792	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT563791	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT563790	hsa-miR-5047	PAR-CLIP	20371350
MIRT563789	hsa-miR-432-3p	PAR-CLIP	20371350
MIRT563788	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT529673	hsa-miR-3133	PAR-CLIP	22012620
MIRT529672	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT529671	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT529670	hsa-miR-4801	PAR-CLIP	22012620
MIRT529669	hsa-miR-5683	PAR-CLIP	22012620
MIRT529668	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT529667	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT529666	hsa-miR-4790-3p	PAR-CLIP	22012620
MIRT529665	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT529664	hsa-miR-421	PAR-CLIP	22012620
MIRT529663	hsa-miR-1261	PAR-CLIP	22012620
MIRT517190	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT517189	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT517188	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT517187	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT517186	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT517185	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT517184	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT517183	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT517182	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT517181	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT517180	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT517179	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT517178	hsa-miR-302e	PAR-CLIP	23446348
MIRT517177	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT517176	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT517175	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT517174	hsa-miR-520b	PAR-CLIP	23446348
MIRT517173	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT517172	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT517171	hsa-miR-520e	PAR-CLIP	23446348
MIRT517170	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT517169	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT517168	hsa-miR-520h	PAR-CLIP	23446348
MIRT517167	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT517166	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT517165	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT517164	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT517163	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT517162	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT517161	hsa-miR-4253	PAR-CLIP	23446348
MIRT517160	hsa-miR-6862-5p	PAR-CLIP	23446348
MIRT517159	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT517158	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT488992	hsa-miR-4506	PAR-CLIP	23592263
MIRT488991	hsa-miR-1244	PAR-CLIP	23592263
MIRT488990	hsa-miR-4703-3p	PAR-CLIP	23592263
MIRT488989	hsa-miR-1225-5p	PAR-CLIP	23592263
MIRT633665	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT633664	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT633663	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT633662	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT633661	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT633660	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT633659	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT633658	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT633657	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT633656	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT633655	hsa-miR-6131	HITS-CLIP	23824327
MIRT633654	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT633653	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT633652	hsa-miR-640	HITS-CLIP	23824327
MIRT633651	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT633650	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT563797	hsa-miR-4802-3p	PAR-CLIP	20371350
MIRT563796	hsa-miR-490-5p	PAR-CLIP	20371350
MIRT563795	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT563794	hsa-miR-107	PAR-CLIP	20371350
MIRT563793	hsa-miR-1193	PAR-CLIP	20371350
MIRT563792	hsa-miR-7156-3p	PAR-CLIP	20371350
MIRT563791	hsa-miR-1301-3p	PAR-CLIP	20371350
MIRT563790	hsa-miR-5047	PAR-CLIP	20371350
MIRT563789	hsa-miR-432-3p	PAR-CLIP	20371350
MIRT563788	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT529673	hsa-miR-3133	PAR-CLIP	22012620
MIRT529672	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT529671	hsa-miR-4731-3p	PAR-CLIP	22012620
MIRT529670	hsa-miR-4801	PAR-CLIP	22012620
MIRT529669	hsa-miR-5683	PAR-CLIP	22012620
MIRT529668	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT529667	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT529666	hsa-miR-4790-3p	PAR-CLIP	22012620
MIRT529665	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT529664	hsa-miR-421	PAR-CLIP	22012620
MIRT529663	hsa-miR-1261	PAR-CLIP	22012620
MIRT517190	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT517189	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT517188	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT517187	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT517186	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT517185	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT517184	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT517183	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT517182	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT517181	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT517180	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT517179	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT517178	hsa-miR-302e	PAR-CLIP	23446348
MIRT517177	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT517176	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT517175	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT517174	hsa-miR-520b	PAR-CLIP	23446348
MIRT517173	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT517172	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT517171	hsa-miR-520e	PAR-CLIP	23446348
MIRT517170	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT517169	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT517168	hsa-miR-520h	PAR-CLIP	23446348
MIRT517167	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT517166	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT517165	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT517164	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT517163	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT517162	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT517161	hsa-miR-4253	PAR-CLIP	23446348
MIRT517160	hsa-miR-6862-5p	PAR-CLIP	23446348
MIRT517159	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT517158	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT488992	hsa-miR-4506	PAR-CLIP	23592263
MIRT488991	hsa-miR-1244	PAR-CLIP	23592263
MIRT488990	hsa-miR-4703-3p	PAR-CLIP	23592263
MIRT488989	hsa-miR-1225-5p	PAR-CLIP	23592263
MIRT1358085	hsa-miR-122	CLIP-seq
MIRT1358086	hsa-miR-1275	CLIP-seq
MIRT1358087	hsa-miR-3179	CLIP-seq
MIRT1358088	hsa-miR-3202	CLIP-seq
MIRT1358089	hsa-miR-3919	CLIP-seq
MIRT1358090	hsa-miR-3921	CLIP-seq
MIRT1358091	hsa-miR-4476	CLIP-seq
MIRT1358092	hsa-miR-4525	CLIP-seq
MIRT1358093	hsa-miR-4534	CLIP-seq
MIRT1358094	hsa-miR-4653-5p	CLIP-seq
MIRT1358095	hsa-miR-4665-5p	CLIP-seq
MIRT1358096	hsa-miR-4716-3p	CLIP-seq
MIRT1358097	hsa-miR-4723-5p	CLIP-seq
MIRT1358098	hsa-miR-4747-5p	CLIP-seq
MIRT1358099	hsa-miR-4766-5p	CLIP-seq
MIRT1358100	hsa-miR-4768-5p	CLIP-seq
MIRT1358101	hsa-miR-625	CLIP-seq
MIRT1358102	hsa-miR-939	CLIP-seq
MIRT1358103	hsa-miR-105	CLIP-seq
MIRT1358104	hsa-miR-1276	CLIP-seq
MIRT1358105	hsa-miR-132	CLIP-seq
MIRT1358106	hsa-miR-194	CLIP-seq
MIRT1358107	hsa-miR-212	CLIP-seq
MIRT1358108	hsa-miR-4311	CLIP-seq
MIRT1358109	hsa-miR-583	CLIP-seq
MIRT2106114	hsa-miR-145	CLIP-seq
MIRT1358092	hsa-miR-4525	CLIP-seq
MIRT2394697	hsa-miR-4768-3p	CLIP-seq
MIRT2394698	hsa-miR-665	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005337	Function	Nucleoside transmembrane transporter activity	IEA
GO:0005345	Function	Purine nucleobase transmembrane transporter activity	NAS	22492015
GO:0005415	Function	Nucleoside:sodium symporter activity	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9124315
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015212	Function	Cytidine transmembrane transporter activity	TAS	22813716
GO:0015213	Function	Uridine transmembrane transporter activity	IDA	22492015
GO:0015293	Function	Symporter activity	IEA
GO:0015389	Function	Pyrimidine- and adenosine-specific:sodium symporter activity	IBA
GO:0015389	Function	Pyrimidine- and adenosine-specific:sodium symporter activity	IDA	9124315, 10455109, 21998139, 32126230
GO:0015855	Process	Pyrimidine nucleobase transport	IBA
GO:0015861	Process	Cytidine transport	IBA
GO:0015861	Process	Cytidine transport	IDA	21998139
GO:0015861	Process	Cytidine transport	TAS	22813716
GO:0015862	Process	Uridine transmembrane transport	IBA
GO:0015862	Process	Uridine transmembrane transport	IDA	21998139, 22492015
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	21998139
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0031526	Component	Brush border membrane	IEA
GO:0031526	Component	Brush border membrane	ISS
GO:0045117	Process	Azole transmembrane transport	IDA	22813716
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IDA	22492015
GO:0180015	Process	Nucleoside import across plasma membrane	IMP	30847922
GO:1901474	Function	Azole transmembrane transporter activity	IDA	22813716
GO:1901642	Process	Nucleoside transmembrane transport	IDA	22492015
GO:1901642	Process	Nucleoside transmembrane transport	IEA
GO:1904823	Process	Purine nucleobase transmembrane transport	NAS	22492015

MIM	HGNC	e!Ensembl
606207	11001	ENSG00000156222

O00337

Protein name

Sodium/nucleoside cotransporter 1 (Concentrative nucleoside transporter 1) (CNT 1) (hCNT1) (Na(+)/nucleoside cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Solute carrier family 28 member 1)

Protein function

Sodium and pyrimidine nucleoside symporter of the plasma membrane that imports uridine, thymidine and cytidine into cells by coupling their transport to the transmembrane sodium electrochemical gradient. Also transports adenosine, an atypical su

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01773	Nucleos_tra2_N	183 → 256	Na+ dependent nucleoside transporter N-terminus	Family
PF07670	Gate	263 → 382	Nucleoside recognition	Domain
PF07662	Nucleos_tra2_C	366 → 590	Na+ dependent nucleoside transporter C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney. {ECO:0000269|PubMed:9124315}.

Sequence

MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFS
RWRNLQPALRARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVL
TFLGHRLLKRLLGPKLRRFLKPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLV
SFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTEPGFIAFEWLGEQIRI
FLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISF
GIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWE
DCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCG
FANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ

Sequence length

649

Interactions

View interactions

	Reactome
			Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC28A1-related disorder	Likely benign; Benign; Affects	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uridine-cytidineuria	Uncertain significance; Benign; Affects	ClinVar ClinVar, HPO ClinVar, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	14581375, 15386342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22580602, 23722537		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25890497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27824142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	36150388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16837820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18053967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19107936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25600708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18604194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34647142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30847922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophagocytic lymphohistiocytosis familial 2	Hemophagocytic lymphohistiocytosis	Pubtator	30658162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	30273369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	BEFREE	30847922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32312148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18538445, 30889042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	17926640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15780063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19107936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16837820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18053967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19107936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16837820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16837820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16837820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35053305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21343396, 23722537, 23934321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18538445, 30889042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	30889042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18538445, 18600541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25600708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21343396, 22580602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20028759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21343396	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	19647871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19647871		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC28A1 (solute carrier family 28 member 1)