Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	91526
Gene name	Ankyrin repeat domain 44
Gene symbol	ANKRD44
Synonyms (NCBI Gene)	ARSBPP6-ARS-B
Chromosome	2
Chromosome location	2q33.1

345

Show/Hide all (345)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017685	hsa-miR-335-5p	Microarray	18185580
MIRT524901	hsa-miR-8485	HITS-CLIP	23824327
MIRT524900	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT524899	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT524898	hsa-miR-603	HITS-CLIP	23824327
MIRT524897	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT524896	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT675458	hsa-miR-4502	HITS-CLIP	23824327
MIRT524895	hsa-miR-3941	HITS-CLIP	23824327
MIRT524894	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT660642	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT524901	hsa-miR-8485	HITS-CLIP	23824327
MIRT524900	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT524899	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT524897	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT524896	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT524895	hsa-miR-3941	HITS-CLIP	23824327
MIRT524894	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT660642	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT524892	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT660641	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT524901	hsa-miR-8485	PAR-CLIP	21572407
MIRT524900	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT524899	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT524898	hsa-miR-603	PAR-CLIP	21572407
MIRT524897	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT524896	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT524895	hsa-miR-3941	PAR-CLIP	21572407
MIRT524894	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524892	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT539263	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT539262	hsa-miR-380-3p	PAR-CLIP	22012620
MIRT539261	hsa-miR-3171	PAR-CLIP	22012620
MIRT524901	hsa-miR-8485	PAR-CLIP	23446348
MIRT524900	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT524899	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT524898	hsa-miR-603	PAR-CLIP	23446348
MIRT524897	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT524896	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT524895	hsa-miR-3941	PAR-CLIP	23446348
MIRT524893	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524894	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524892	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT524901	hsa-miR-8485	HITS-CLIP	23824327
MIRT524900	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT524899	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT524898	hsa-miR-603	HITS-CLIP	23824327
MIRT524897	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT524896	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT675458	hsa-miR-4502	HITS-CLIP	23824327
MIRT524895	hsa-miR-3941	HITS-CLIP	23824327
MIRT524894	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT660642	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT524901	hsa-miR-8485	HITS-CLIP	23824327
MIRT524900	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT524899	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT524897	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT524896	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT524895	hsa-miR-3941	HITS-CLIP	23824327
MIRT524894	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT660642	hsa-miR-7158-3p	HITS-CLIP	23824327
MIRT524892	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT660641	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT613330	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT613329	hsa-miR-5096	HITS-CLIP	23824327
MIRT204551	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT524901	hsa-miR-8485	PAR-CLIP	21572407
MIRT524900	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT524899	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT524898	hsa-miR-603	PAR-CLIP	21572407
MIRT524897	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT524896	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT524895	hsa-miR-3941	PAR-CLIP	21572407
MIRT524894	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524892	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT539263	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT539262	hsa-miR-380-3p	PAR-CLIP	22012620
MIRT539261	hsa-miR-3171	PAR-CLIP	22012620
MIRT524901	hsa-miR-8485	PAR-CLIP	23446348
MIRT524900	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT524899	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT524898	hsa-miR-603	PAR-CLIP	23446348
MIRT524897	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT524896	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT524895	hsa-miR-3941	PAR-CLIP	23446348
MIRT524893	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524894	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524892	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT784072	hsa-miR-124	CLIP-seq
MIRT784073	hsa-miR-1253	CLIP-seq
MIRT784074	hsa-miR-1255a	CLIP-seq
MIRT784075	hsa-miR-1255b	CLIP-seq
MIRT784076	hsa-miR-1279	CLIP-seq
MIRT784077	hsa-miR-130a	CLIP-seq
MIRT784078	hsa-miR-130b	CLIP-seq
MIRT784079	hsa-miR-141	CLIP-seq
MIRT784080	hsa-miR-192	CLIP-seq
MIRT784081	hsa-miR-200a	CLIP-seq
MIRT784082	hsa-miR-200b	CLIP-seq
MIRT784083	hsa-miR-200c	CLIP-seq
MIRT784084	hsa-miR-215	CLIP-seq
MIRT784085	hsa-miR-219-5p	CLIP-seq
MIRT784086	hsa-miR-2278	CLIP-seq
MIRT784087	hsa-miR-25	CLIP-seq
MIRT784088	hsa-miR-299-5p	CLIP-seq
MIRT784089	hsa-miR-300	CLIP-seq
MIRT784090	hsa-miR-301a	CLIP-seq
MIRT784091	hsa-miR-301b	CLIP-seq
MIRT784092	hsa-miR-302a	CLIP-seq
MIRT784093	hsa-miR-302b	CLIP-seq
MIRT784094	hsa-miR-302c	CLIP-seq
MIRT784095	hsa-miR-302d	CLIP-seq
MIRT784096	hsa-miR-302e	CLIP-seq
MIRT784097	hsa-miR-3128	CLIP-seq
MIRT784098	hsa-miR-3140-3p	CLIP-seq
MIRT784099	hsa-miR-3146	CLIP-seq
MIRT784100	hsa-miR-3149	CLIP-seq
MIRT784101	hsa-miR-3163	CLIP-seq
MIRT784102	hsa-miR-3166	CLIP-seq
MIRT784103	hsa-miR-32	CLIP-seq
MIRT784104	hsa-miR-362-5p	CLIP-seq
MIRT784105	hsa-miR-363	CLIP-seq
MIRT784106	hsa-miR-3662	CLIP-seq
MIRT784107	hsa-miR-3666	CLIP-seq
MIRT784108	hsa-miR-367	CLIP-seq
MIRT784109	hsa-miR-3679-3p	CLIP-seq
MIRT784110	hsa-miR-369-3p	CLIP-seq
MIRT784111	hsa-miR-372	CLIP-seq
MIRT784112	hsa-miR-373	CLIP-seq
MIRT784113	hsa-miR-374a	CLIP-seq
MIRT784114	hsa-miR-374b	CLIP-seq
MIRT784115	hsa-miR-381	CLIP-seq
MIRT784116	hsa-miR-3942-3p	CLIP-seq
MIRT784117	hsa-miR-3973	CLIP-seq
MIRT784118	hsa-miR-410	CLIP-seq
MIRT784119	hsa-miR-429	CLIP-seq
MIRT784120	hsa-miR-4295	CLIP-seq
MIRT784121	hsa-miR-4330	CLIP-seq
MIRT784122	hsa-miR-4420	CLIP-seq
MIRT784123	hsa-miR-4445	CLIP-seq
MIRT784124	hsa-miR-4446-5p	CLIP-seq
MIRT784125	hsa-miR-4470	CLIP-seq
MIRT784126	hsa-miR-4514	CLIP-seq
MIRT784127	hsa-miR-454	CLIP-seq
MIRT784128	hsa-miR-4666-3p	CLIP-seq
MIRT784129	hsa-miR-4692	CLIP-seq
MIRT784130	hsa-miR-4699-5p	CLIP-seq
MIRT784131	hsa-miR-4703-3p	CLIP-seq
MIRT784132	hsa-miR-4724-5p	CLIP-seq
MIRT784133	hsa-miR-4766-3p	CLIP-seq
MIRT784134	hsa-miR-4782-3p	CLIP-seq
MIRT784135	hsa-miR-491-3p	CLIP-seq
MIRT784136	hsa-miR-494	CLIP-seq
MIRT784137	hsa-miR-500b	CLIP-seq
MIRT784138	hsa-miR-506	CLIP-seq
MIRT784139	hsa-miR-519a	CLIP-seq
MIRT784140	hsa-miR-519b-3p	CLIP-seq
MIRT784141	hsa-miR-519c-3p	CLIP-seq
MIRT784142	hsa-miR-520a-3p	CLIP-seq
MIRT784143	hsa-miR-520b	CLIP-seq
MIRT784144	hsa-miR-520c-3p	CLIP-seq
MIRT784145	hsa-miR-520d-3p	CLIP-seq
MIRT784146	hsa-miR-520d-5p	CLIP-seq
MIRT784147	hsa-miR-520e	CLIP-seq
MIRT784148	hsa-miR-520g	CLIP-seq
MIRT784149	hsa-miR-520h	CLIP-seq
MIRT784150	hsa-miR-524-5p	CLIP-seq
MIRT784151	hsa-miR-548ad	CLIP-seq
MIRT784152	hsa-miR-548an	CLIP-seq
MIRT784153	hsa-miR-548p	CLIP-seq
MIRT784154	hsa-miR-584	CLIP-seq
MIRT784155	hsa-miR-607	CLIP-seq
MIRT784156	hsa-miR-668	CLIP-seq
MIRT784157	hsa-miR-92a	CLIP-seq
MIRT784158	hsa-miR-92b	CLIP-seq
MIRT1931266	hsa-miR-1236	CLIP-seq
MIRT1931267	hsa-miR-1238	CLIP-seq
MIRT1931268	hsa-miR-1273e	CLIP-seq
MIRT1931269	hsa-miR-1297	CLIP-seq
MIRT784079	hsa-miR-141	CLIP-seq
MIRT784080	hsa-miR-192	CLIP-seq
MIRT784081	hsa-miR-200a	CLIP-seq
MIRT1931270	hsa-miR-203	CLIP-seq
MIRT784084	hsa-miR-215	CLIP-seq
MIRT1931271	hsa-miR-218	CLIP-seq
MIRT1931272	hsa-miR-26a	CLIP-seq
MIRT1931273	hsa-miR-26b	CLIP-seq
MIRT1931274	hsa-miR-3120-3p	CLIP-seq
MIRT1931275	hsa-miR-3120-5p	CLIP-seq
MIRT1931276	hsa-miR-421	CLIP-seq
MIRT1931277	hsa-miR-4465	CLIP-seq
MIRT1931278	hsa-miR-4652-3p	CLIP-seq
MIRT1931279	hsa-miR-4710	CLIP-seq
MIRT1931280	hsa-miR-4764-5p	CLIP-seq
MIRT1931281	hsa-miR-4792	CLIP-seq
MIRT784146	hsa-miR-520d-5p	CLIP-seq
MIRT784150	hsa-miR-524-5p	CLIP-seq
MIRT1931282	hsa-miR-545	CLIP-seq
MIRT1931283	hsa-miR-548l	CLIP-seq
MIRT1931284	hsa-miR-548n	CLIP-seq
MIRT784153	hsa-miR-548p	CLIP-seq
MIRT1931285	hsa-miR-593	CLIP-seq
MIRT1931286	hsa-miR-636	CLIP-seq
MIRT1931287	hsa-miR-642b	CLIP-seq
MIRT2171857	hsa-miR-103b	CLIP-seq
MIRT2171858	hsa-miR-1183	CLIP-seq
MIRT1931266	hsa-miR-1236	CLIP-seq
MIRT1931269	hsa-miR-1297	CLIP-seq
MIRT784079	hsa-miR-141	CLIP-seq
MIRT784081	hsa-miR-200a	CLIP-seq
MIRT1931272	hsa-miR-26a	CLIP-seq
MIRT1931273	hsa-miR-26b	CLIP-seq
MIRT1931275	hsa-miR-3120-5p	CLIP-seq
MIRT784100	hsa-miR-3149	CLIP-seq
MIRT1931277	hsa-miR-4465	CLIP-seq
MIRT1931278	hsa-miR-4652-3p	CLIP-seq
MIRT2171859	hsa-miR-4693-5p	CLIP-seq
MIRT2171860	hsa-miR-4699-3p	CLIP-seq
MIRT2171861	hsa-miR-511	CLIP-seq
MIRT1931285	hsa-miR-593	CLIP-seq
MIRT2171862	hsa-miR-640	CLIP-seq
MIRT2435340	hsa-miR-451b	CLIP-seq
MIRT2435341	hsa-miR-4777-5p	CLIP-seq
MIRT2435342	hsa-miR-518d-5p	CLIP-seq
MIRT2435343	hsa-miR-519b-5p	CLIP-seq
MIRT2435344	hsa-miR-519c-5p	CLIP-seq
MIRT2435345	hsa-miR-520c-5p	CLIP-seq
MIRT2435346	hsa-miR-526a	CLIP-seq
MIRT2435347	hsa-miR-587	CLIP-seq
MIRT2443698	hsa-miR-4764-3p	CLIP-seq
MIRT2474946	hsa-miR-1323	CLIP-seq
MIRT784080	hsa-miR-192	CLIP-seq
MIRT784082	hsa-miR-200b	CLIP-seq
MIRT784083	hsa-miR-200c	CLIP-seq
MIRT2474947	hsa-miR-208a	CLIP-seq
MIRT2474948	hsa-miR-208b	CLIP-seq
MIRT784084	hsa-miR-215	CLIP-seq
MIRT784086	hsa-miR-2278	CLIP-seq
MIRT784087	hsa-miR-25	CLIP-seq
MIRT784088	hsa-miR-299-5p	CLIP-seq
MIRT784098	hsa-miR-3140-3p	CLIP-seq
MIRT2474949	hsa-miR-3145-3p	CLIP-seq
MIRT784099	hsa-miR-3146	CLIP-seq
MIRT784100	hsa-miR-3149	CLIP-seq
MIRT784101	hsa-miR-3163	CLIP-seq
MIRT784103	hsa-miR-32	CLIP-seq
MIRT2474950	hsa-miR-337-3p	CLIP-seq
MIRT2474951	hsa-miR-33a	CLIP-seq
MIRT2474952	hsa-miR-33b	CLIP-seq
MIRT784105	hsa-miR-363	CLIP-seq
MIRT784106	hsa-miR-3662	CLIP-seq
MIRT2474953	hsa-miR-3668	CLIP-seq
MIRT784108	hsa-miR-367	CLIP-seq
MIRT784109	hsa-miR-3679-3p	CLIP-seq
MIRT784110	hsa-miR-369-3p	CLIP-seq
MIRT784113	hsa-miR-374a	CLIP-seq
MIRT784114	hsa-miR-374b	CLIP-seq
MIRT784119	hsa-miR-429	CLIP-seq
MIRT2474954	hsa-miR-4422	CLIP-seq
MIRT784124	hsa-miR-4446-5p	CLIP-seq
MIRT2474955	hsa-miR-4452	CLIP-seq
MIRT2474956	hsa-miR-4503	CLIP-seq
MIRT784146	hsa-miR-520d-5p	CLIP-seq
MIRT784150	hsa-miR-524-5p	CLIP-seq
MIRT2474957	hsa-miR-548o	CLIP-seq
MIRT784154	hsa-miR-584	CLIP-seq
MIRT784156	hsa-miR-668	CLIP-seq
MIRT784157	hsa-miR-92a	CLIP-seq
MIRT784158	hsa-miR-92b	CLIP-seq
MIRT784076	hsa-miR-1279	CLIP-seq
MIRT2474946	hsa-miR-1323	CLIP-seq
MIRT784080	hsa-miR-192	CLIP-seq
MIRT784082	hsa-miR-200b	CLIP-seq
MIRT784083	hsa-miR-200c	CLIP-seq
MIRT2474947	hsa-miR-208a	CLIP-seq
MIRT2474948	hsa-miR-208b	CLIP-seq
MIRT784084	hsa-miR-215	CLIP-seq
MIRT784086	hsa-miR-2278	CLIP-seq
MIRT784087	hsa-miR-25	CLIP-seq
MIRT784088	hsa-miR-299-5p	CLIP-seq
MIRT784098	hsa-miR-3140-3p	CLIP-seq
MIRT2474949	hsa-miR-3145-3p	CLIP-seq
MIRT784099	hsa-miR-3146	CLIP-seq
MIRT784100	hsa-miR-3149	CLIP-seq
MIRT784101	hsa-miR-3163	CLIP-seq
MIRT784103	hsa-miR-32	CLIP-seq
MIRT2474950	hsa-miR-337-3p	CLIP-seq
MIRT2474951	hsa-miR-33a	CLIP-seq
MIRT2474952	hsa-miR-33b	CLIP-seq
MIRT784105	hsa-miR-363	CLIP-seq
MIRT784106	hsa-miR-3662	CLIP-seq
MIRT2474953	hsa-miR-3668	CLIP-seq
MIRT784108	hsa-miR-367	CLIP-seq
MIRT784109	hsa-miR-3679-3p	CLIP-seq
MIRT784110	hsa-miR-369-3p	CLIP-seq
MIRT784113	hsa-miR-374a	CLIP-seq
MIRT784114	hsa-miR-374b	CLIP-seq
MIRT2675031	hsa-miR-3912	CLIP-seq
MIRT784119	hsa-miR-429	CLIP-seq
MIRT2474954	hsa-miR-4422	CLIP-seq
MIRT784124	hsa-miR-4446-5p	CLIP-seq
MIRT2474955	hsa-miR-4452	CLIP-seq
MIRT2474956	hsa-miR-4503	CLIP-seq
MIRT2675032	hsa-miR-4760-5p	CLIP-seq
MIRT784146	hsa-miR-520d-5p	CLIP-seq
MIRT784150	hsa-miR-524-5p	CLIP-seq
MIRT2474957	hsa-miR-548o	CLIP-seq
MIRT2675033	hsa-miR-579	CLIP-seq
MIRT784154	hsa-miR-584	CLIP-seq
MIRT2675034	hsa-miR-624	CLIP-seq
MIRT2675035	hsa-miR-664	CLIP-seq
MIRT784156	hsa-miR-668	CLIP-seq
MIRT784157	hsa-miR-92a	CLIP-seq
MIRT784158	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16555005, 18186651, 24255178, 25416956, 31515488, 32814053, 33961781, 35271311

MIM	HGNC	e!Ensembl
620861	25259	ENSG00000065413

Q8N8A2

Protein name

Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B (PP6-ARS-B) (Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B) (Ankyrin repeat domain-containing protein 44)

Protein function

Putative regulatory subunit of protein phosphatase 6 (PP6) that may be involved in the recognition of phosphoprotein substrates.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	5 → 71	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	78 → 170	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	111 → 203	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	177 → 269	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	234 → 303	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	276 → 368	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	354 → 435	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	376 → 468	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	433 → 563	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	500 → 597	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	556 → 630	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	628 → 700	Ankyrin repeats (3 copies)	Repeat
PF13637	Ank_4	705 → 760		Repeat
PF12796	Ank_2	752 → 833	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	827 → 903	Ankyrin repeats (3 copies)	Repeat
PF12796	Ank_2	902 → 972	Ankyrin repeats (3 copies)	Repeat

Sequence

MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA
SDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAA
AYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKG
RTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNP
EAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQ
MLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWAC
YNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLT
VKDKDLNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEE
LLAKGACVLAVDENASRSNGPRSTPGTAVQKEE

Sequence length

993

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder with hypotonia, seizures, and absent language	Likely pathogenic	rs2469332282	RCV003991504	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACIC AORTIC ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (83)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	19668339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	GWASCAT_DG	27418160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	GWASCAT_DG	27418160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28659610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28659610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28659610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31297336, 31380291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	29667349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	28659610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28659610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical myelopathy	Cervical myelopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30353303		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	26016623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31832401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	29376740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	31660881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29371215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17324393, 21968085, 29703589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17324393, 18299243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	22550062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	40362587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30524696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia	Epiphyseal dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	18062719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	18062719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	18062719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	36611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29371215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21968085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30353303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	GWASCAT_DG	27418160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	28659610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31660881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31660881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3465594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	36611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	CLINVAR_DG	1550123, 16435196, 17458871, 21514195, 23557332, 8116615, 8723688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	38182665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	6114860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	25338677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	30985854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31297336, 31380291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	22923026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29081414, 30801800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27605497, 27926479, 29794138, 6114860		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27926479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27926479	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28074617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	18285341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	28088454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	BEFREE	14608657, 19690584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	BEFREE	14608657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis type 6, rapidly progressing	Mucopolysaccharidosis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis type 6, slowly progressing	Mucopolysaccharidosis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	14608657, 19690584, 31615002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	BEFREE	10036316, 10098600, 11668612, 11802522, 11939792, 122048, 12904606, 14608657, 14974081, 1550123, 15930196, 16435196, 17161971, 1718978, 17458871 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	UNIPROT_DG	10036316, 10738004, 11802522, 14974081, 1550123, 1718978, 19259130, 8116615, 8125475, 8541342, 8651289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	CLINVAR_DG	10036316, 10206678, 10738004, 10923267, 11802522, 1301949, 14974081, 1550123, 15603718, 16435196, 16949067, 17161971, 17458871, 17643332, 17672828 View all (49 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	Pubtator	10036316, 11815337, 1550123, 1718978, 1901688, 19259130, 22550062, 23023219, 23557332, 23826140, 24107440, 26609033, 27512882, 29202552, 30335002 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	LHGDN	17458871, 17643332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	CTD_human_DG	17458871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	Pubtator	25797215, 30335002	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	GENOMICS_ENGLAND_DG	27604308, 30083803, 8651289, 9514506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis, MPS-IV-A	Mucopolysaccharidosis	BEFREE	14608657, 18546277, 26016623, 29326871, 30442189, 31615002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29371215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	31660881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28421867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	22907655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 6	Osteogenesis imperfecta	Pubtator	30335002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	30075049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	BEFREE	14608657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29081414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28421867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	31660881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	38165228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANKRD44 (ankyrin repeat domain 44)