Gene Gene information from NCBI Gene database.
Entrez ID 91445
Gene name Ring finger protein 185
Gene symbol RNF185
Synonyms (NCBI Gene)
-
Chromosome 22
Chromosome location 22q12.2
miRNA miRNA information provided by mirtarbase database.
644
miRTarBase ID miRNA Experiments Reference
MIRT042563 hsa-miR-423-3p CLASH 23622248
MIRT040228 hsa-miR-615-3p CLASH 23622248
MIRT499677 hsa-miR-551b-5p PAR-CLIP 24398324
MIRT205530 hsa-miR-3125 PAR-CLIP 24398324
MIRT205532 hsa-miR-3916 PAR-CLIP 24398324
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 19549727, 21931693, 24019521, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620096 26783 ENSG00000138942
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96GF1
Protein name E3 ubiquitin-protein ligase RNF185 (EC 2.3.2.27) (RING finger protein 185)
Protein function E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693). Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 35 85 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:27485036}.
Sequence
MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCW
PCLHQWLETRPNRQVCPVCKAGISR
DKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR
GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF
VALVIMFWLLIA
Sequence length 192
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum   ABC-family proteins mediated transport
Defective CFTR causes cystic fibrosis
ER Quality Control Compartment (ERQC)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ESSENTIAL TREMOR GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Diabetic Nephropathy Diabetic Nephropathy GWASDB_DG 21150874
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 35183197 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 35183197 Inhibit
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 28273161 Stimulate
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus, Systemic Lupus Erythematosus BEFREE 28273161
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 29481911
★☆☆☆☆
Found in Text Mining only
Stomach Carcinoma Stomach Carcinoma BEFREE 29481911
★☆☆☆☆
Found in Text Mining only