CCNE2 (cyclin E2)

Gene

• Entrez ID: 9134
• Gene name: Cyclin E2
• Gene symbol: CCNE2
• Synonyms (NCBI Gene): CYCE2
• Chromosome: 8
• Chromosome location: 8q22.1
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000965	hsa-miR-126-3p	Luciferase reporter assay	18834857
MIRT000768	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT000767	hsa-miR-34b-5p	Review, Luciferase reporter assay	19461653
MIRT000766	hsa-miR-34c-5p	Review, Luciferase reporter assay	19461653
MIRT000768	hsa-miR-34a-5p	Review, Luciferase reporter assay, Western blot, Microarray	17914404
MIRT000645	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT000768	hsa-miR-34a-5p	Review	20130964
MIRT003448	hsa-miR-34b-3p	Review	20130964
MIRT000766	hsa-miR-34c-5p	Review	20130964
MIRT000111	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	19524505
MIRT000111	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	19524505
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006347	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006350	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006347	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006350	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006303	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR	22384020
MIRT006347	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006350	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006665	hsa-miR-200a-3p	Luciferase reporter assay	22183793
MIRT006666	hsa-miR-200b-3p	Luciferase reporter assay	22183793
MIRT006667	hsa-miR-200c-3p	Luciferase reporter assay	22183793
MIRT028325	hsa-miR-32-5p	Sequencing	20371350
MIRT031722	hsa-miR-16-5p	Sequencing	20371350
MIRT050210	hsa-miR-25-3p	CLASH	23622248
MIRT048230	hsa-miR-196a-5p	CLASH	23622248
MIRT507854	hsa-miR-577	PAR-CLIP	20371350
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031722	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507851	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507850	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT507849	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT000645	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT507847	hsa-miR-646	PAR-CLIP	20371350
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507854	hsa-miR-577	PAR-CLIP	21572407
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031722	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507851	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507850	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT507849	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000645	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT507847	hsa-miR-646	PAR-CLIP	21572407
MIRT507846	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT106609	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT106608	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT507843	hsa-miR-556-3p	PAR-CLIP	21572407
MIRT507854	hsa-miR-577	PAR-CLIP	21572407
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031722	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507851	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507850	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT507849	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000645	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT507847	hsa-miR-646	PAR-CLIP	21572407
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT000768	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT006347	hsa-miR-449a	PAR-CLIP	23446348
MIRT006350	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT000766	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507863	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT507861	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT507862	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT507860	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT507859	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT507858	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT507857	hsa-miR-6069	PAR-CLIP	23446348
MIRT507856	hsa-miR-1257	PAR-CLIP	23446348
MIRT507855	hsa-miR-3611	PAR-CLIP	23446348
MIRT507854	hsa-miR-577	PAR-CLIP	23446348
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031722	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507851	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507850	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT507849	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT000645	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507847	hsa-miR-646	PAR-CLIP	23446348
MIRT507846	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT106609	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT106608	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507843	hsa-miR-556-3p	PAR-CLIP	23446348
MIRT006303	hsa-miR-30b-5p	qRT-PCR, Western blot	28120942
MIRT000111	hsa-miR-26a-5p	qRT-PCR, Western blot	28120942
MIRT731697	hsa-miR-664b-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	28176879
MIRT731697	hsa-miR-664b-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	28176879
MIRT736272	hsa-miR-30a-5p	qRT-PCR, Western blot	26555189
MIRT736272	hsa-miR-30a-5p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	27431942
MIRT734523	rno-miR-204-5p	Flow cytometry, qRT-PCR, Western blotting	32500147
MIRT736272	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC)	34128973
MIRT000768	hsa-miR-34a-5p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	33614246
MIRT507854	hsa-miR-577	PAR-CLIP	20371350
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031722	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT507851	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT507850	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT507849	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT000645	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT507847	hsa-miR-646	PAR-CLIP	20371350
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507854	hsa-miR-577	PAR-CLIP	21572407
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031722	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507851	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507850	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT507849	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000645	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT507847	hsa-miR-646	PAR-CLIP	21572407
MIRT507846	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT106609	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT106608	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT507843	hsa-miR-556-3p	PAR-CLIP	21572407
MIRT507854	hsa-miR-577	PAR-CLIP	21572407
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031722	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT507851	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT507850	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT507849	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT000645	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT507847	hsa-miR-646	PAR-CLIP	21572407
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT000768	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT006347	hsa-miR-449a	PAR-CLIP	23446348
MIRT006350	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT000766	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507863	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT507861	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT507862	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT507860	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT507859	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT507858	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT507857	hsa-miR-6069	PAR-CLIP	23446348
MIRT507856	hsa-miR-1257	PAR-CLIP	23446348
MIRT507855	hsa-miR-3611	PAR-CLIP	23446348
MIRT507854	hsa-miR-577	PAR-CLIP	23446348
MIRT507853	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT507852	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031722	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT507851	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT507850	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT507849	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT507848	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT000645	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507847	hsa-miR-646	PAR-CLIP	23446348
MIRT507846	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT106609	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT106608	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT507845	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT507844	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507843	hsa-miR-556-3p	PAR-CLIP	23446348
MIRT736272	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	34589618
MIRT736272	hsa-miR-30a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	34589618
MIRT871848	hsa-miR-106a	CLIP-seq
MIRT871849	hsa-miR-106b	CLIP-seq
MIRT871850	hsa-miR-1305	CLIP-seq
MIRT871851	hsa-miR-17	CLIP-seq
MIRT871852	hsa-miR-20a	CLIP-seq
MIRT871853	hsa-miR-20b	CLIP-seq
MIRT871854	hsa-miR-25	CLIP-seq
MIRT871855	hsa-miR-30a	CLIP-seq
MIRT871856	hsa-miR-30b	CLIP-seq
MIRT871857	hsa-miR-30c	CLIP-seq
MIRT871858	hsa-miR-30d	CLIP-seq
MIRT871859	hsa-miR-30e	CLIP-seq
MIRT871860	hsa-miR-3117-5p	CLIP-seq
MIRT871861	hsa-miR-3121-3p	CLIP-seq
MIRT871862	hsa-miR-3164	CLIP-seq
MIRT871863	hsa-miR-3189-3p	CLIP-seq
MIRT871864	hsa-miR-32	CLIP-seq
MIRT871865	hsa-miR-335	CLIP-seq
MIRT871866	hsa-miR-342-3p	CLIP-seq
MIRT871867	hsa-miR-34c-3p	CLIP-seq
MIRT871868	hsa-miR-3609	CLIP-seq
MIRT871869	hsa-miR-363	CLIP-seq
MIRT871870	hsa-miR-367	CLIP-seq
MIRT871871	hsa-miR-4325	CLIP-seq
MIRT871872	hsa-miR-4652-3p	CLIP-seq
MIRT871873	hsa-miR-4705	CLIP-seq
MIRT871874	hsa-miR-4712-5p	CLIP-seq
MIRT871875	hsa-miR-4775	CLIP-seq
MIRT871876	hsa-miR-4796-3p	CLIP-seq
MIRT871877	hsa-miR-498	CLIP-seq
MIRT871878	hsa-miR-513a-3p	CLIP-seq
MIRT871879	hsa-miR-514	CLIP-seq
MIRT871880	hsa-miR-514b-3p	CLIP-seq
MIRT871881	hsa-miR-519d	CLIP-seq
MIRT871882	hsa-miR-548ah	CLIP-seq
MIRT871883	hsa-miR-548b-3p	CLIP-seq
MIRT871884	hsa-miR-590-3p	CLIP-seq
MIRT871885	hsa-miR-617	CLIP-seq
MIRT871886	hsa-miR-770-5p	CLIP-seq
MIRT871887	hsa-miR-92a	CLIP-seq
MIRT871888	hsa-miR-92b	CLIP-seq
MIRT871889	hsa-miR-93	CLIP-seq
MIRT871860	hsa-miR-3117-5p	CLIP-seq
MIRT1958736	hsa-miR-374c	CLIP-seq
MIRT1958737	hsa-miR-4452	CLIP-seq
MIRT1958738	hsa-miR-655	CLIP-seq
MIRT871848	hsa-miR-106a	CLIP-seq
MIRT871849	hsa-miR-106b	CLIP-seq
MIRT2195467	hsa-miR-1243	CLIP-seq
MIRT2195468	hsa-miR-1253	CLIP-seq
MIRT2195469	hsa-miR-1284	CLIP-seq
MIRT2195470	hsa-miR-1287	CLIP-seq
MIRT2195471	hsa-miR-1290	CLIP-seq
MIRT2195472	hsa-miR-132	CLIP-seq
MIRT2195473	hsa-miR-1323	CLIP-seq
MIRT2195474	hsa-miR-141	CLIP-seq
MIRT2195475	hsa-miR-151-3p	CLIP-seq
MIRT871851	hsa-miR-17	CLIP-seq
MIRT2195476	hsa-miR-200a	CLIP-seq
MIRT871852	hsa-miR-20a	CLIP-seq
MIRT871853	hsa-miR-20b	CLIP-seq
MIRT2195477	hsa-miR-212	CLIP-seq
MIRT2195478	hsa-miR-219-2-3p	CLIP-seq
MIRT2195479	hsa-miR-23a	CLIP-seq
MIRT2195480	hsa-miR-23b	CLIP-seq
MIRT2195481	hsa-miR-23c	CLIP-seq
MIRT2195482	hsa-miR-2467-5p	CLIP-seq
MIRT2195483	hsa-miR-2964a-3p	CLIP-seq
MIRT871855	hsa-miR-30a	CLIP-seq
MIRT871856	hsa-miR-30b	CLIP-seq
MIRT871857	hsa-miR-30c	CLIP-seq
MIRT871858	hsa-miR-30d	CLIP-seq
MIRT871859	hsa-miR-30e	CLIP-seq
MIRT871860	hsa-miR-3117-5p	CLIP-seq
MIRT2195484	hsa-miR-3120-3p	CLIP-seq
MIRT871861	hsa-miR-3121-3p	CLIP-seq
MIRT871862	hsa-miR-3164	CLIP-seq
MIRT2195485	hsa-miR-3167	CLIP-seq
MIRT2195486	hsa-miR-3168	CLIP-seq
MIRT2195487	hsa-miR-3188	CLIP-seq
MIRT871866	hsa-miR-342-3p	CLIP-seq
MIRT2195488	hsa-miR-34a	CLIP-seq
MIRT871868	hsa-miR-3609	CLIP-seq
MIRT2195489	hsa-miR-3617	CLIP-seq
MIRT2195490	hsa-miR-3652	CLIP-seq
MIRT2195491	hsa-miR-370	CLIP-seq
MIRT2195492	hsa-miR-3975	CLIP-seq
MIRT2195493	hsa-miR-4263	CLIP-seq
MIRT2195494	hsa-miR-4277	CLIP-seq
MIRT2195495	hsa-miR-4430	CLIP-seq
MIRT2195496	hsa-miR-4434	CLIP-seq
MIRT2195497	hsa-miR-4436b-3p	CLIP-seq
MIRT1958737	hsa-miR-4452	CLIP-seq
MIRT2195498	hsa-miR-4463	CLIP-seq
MIRT2195499	hsa-miR-4499	CLIP-seq
MIRT2195500	hsa-miR-449b	CLIP-seq
MIRT2195501	hsa-miR-4516	CLIP-seq
MIRT2195502	hsa-miR-455-3p	CLIP-seq
MIRT2195503	hsa-miR-4668-3p	CLIP-seq
MIRT2195504	hsa-miR-4719	CLIP-seq
MIRT2195505	hsa-miR-4761-3p	CLIP-seq
MIRT871875	hsa-miR-4775	CLIP-seq
MIRT871876	hsa-miR-4796-3p	CLIP-seq
MIRT2195506	hsa-miR-4802-5p	CLIP-seq
MIRT2195507	hsa-miR-4803	CLIP-seq
MIRT2195508	hsa-miR-485-3p	CLIP-seq
MIRT2195509	hsa-miR-485-5p	CLIP-seq
MIRT2195510	hsa-miR-488	CLIP-seq
MIRT871878	hsa-miR-513a-3p	CLIP-seq
MIRT2195511	hsa-miR-513b	CLIP-seq
MIRT871881	hsa-miR-519d	CLIP-seq
MIRT2195512	hsa-miR-548a-3p	CLIP-seq
MIRT871882	hsa-miR-548ah	CLIP-seq
MIRT2195513	hsa-miR-548e	CLIP-seq
MIRT2195514	hsa-miR-548f	CLIP-seq
MIRT2195515	hsa-miR-548o	CLIP-seq
MIRT2195516	hsa-miR-576-5p	CLIP-seq
MIRT871884	hsa-miR-590-3p	CLIP-seq
MIRT871885	hsa-miR-617	CLIP-seq
MIRT2195517	hsa-miR-641	CLIP-seq
MIRT2195518	hsa-miR-765	CLIP-seq
MIRT2195519	hsa-miR-802	CLIP-seq
MIRT2195520	hsa-miR-876-5p	CLIP-seq
MIRT871889	hsa-miR-93	CLIP-seq
MIRT2195484	hsa-miR-3120-3p	CLIP-seq
MIRT2385710	hsa-miR-511	CLIP-seq
MIRT871855	hsa-miR-30a	CLIP-seq
MIRT871856	hsa-miR-30b	CLIP-seq
MIRT871857	hsa-miR-30c	CLIP-seq
MIRT871858	hsa-miR-30d	CLIP-seq
MIRT871859	hsa-miR-30e	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CHD8	Activation	19255092

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	9840943
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	9840943
GO:0000723	Process	Telomere maintenance	IEA
GO:0005515	Function	Protein binding	IPI	9840943, 15232106, 23455922, 23602568, 24358021, 25852190, 26496610, 28514442, 30833792, 32814053, 33961781, 34591612, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006270	Process	DNA replication initiation	IEA
GO:0007129	Process	Homologous chromosome pairing at meiosis	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0032880	Process	Regulation of protein localization	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070192	Process	Chromosome organization involved in meiotic cell cycle	IEA
GO:0097134	Component	Cyclin E1-CDK2 complex	IBA
GO:0097135	Component	Cyclin E2-CDK2 complex	IBA
GO:0097135	Component	Cyclin E2-CDK2 complex	IEA
GO:0097135	Component	Cyclin E2-CDK2 complex	IPI	15232106
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA

Other IDs

• MIM: 603775
• HGNC: 1590
• e!Ensembl: ENSG00000175305

Protein

• UniProt ID: O96020
• Protein name: G1/S-specific cyclin-E2
• Protein function: Essential for the control of the cell cycle at the late G1 and early S phase.
• PDB: 8HN9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	112 → 239	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	241 → 363	Cyclin, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: According to PubMed:9858585, highest levels of expression in adult testis, thymus and brain. Lower levels in placenta, spleen and colon. Consistently elevated levels in tumor-derived cells compared to non-transformed proliferating cell
• Sequence:

  MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
  VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
  ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
  NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
  VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
  LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
  TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH

• Sequence length: 404

Pathways

KEGG:

Cell cycle
Oocyte meiosis
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Cushing syndrome
Hepatitis B
Measles
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Prostate cancer
Small cell lung cancer
Gastric cancer

Reactome:

G0 and Early G1
SCF(Skp2)-mediated degradation of p27/p21
DNA Damage/Telomere Stress Induced Senescence
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
CDK-mediated phosphorylation and removal of Cdc6
Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes
Cyclin E associated events during G1/S transition
p53-Dependent G1 DNA Damage Response

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27425595		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26057453, 31455378		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12466974, 16929516, 23790951, 24073403, 25596745, 26265440, 30157476, 31777591		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21789246, 23324395, 24073403, 25596745, 26265440, 28120942, 33455094, 36233194, 38643462	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36068491, 36233194	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26265440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29782647, 33686022	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26057453, 31455378		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36123627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24176298		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24157941		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29794421	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28339466		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	28339466	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37540242	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24176298		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30990963		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30990963		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37417427	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35235759	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27362652		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27362652	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37310408	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12417757, 15935816		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12417757	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23181557, 26600399	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26600399	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11212263		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23943028, 29551768, 30150405		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28056099, 32338437, 32596300	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	25475054	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12466974, 14510182, 16929516, 23790951, 24073403, 25596745, 26265440, 30157476, 31777591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30990963		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30150405		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24116110		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19107233, 27431942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26378658		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26057453, 31455378		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19084516, 27431942, 29180617, 30150405		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24157941		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	11687642		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12466974		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12466974, 16740753		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	23790951		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25973099	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24116110, 27425595, 28176879		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25843294, 30557355		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	18984771		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28537669	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24116110		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	19107233, 27431942		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19107233	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	16899113	Associate	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25550809		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25550809, 37062286	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	29464035		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26378658		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26378658		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35968508	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28176879		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28176879	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	23790951		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26057453	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	17003493	Associate	★☆☆☆☆ Found in Text Mining only