CCNB2 (cyclin B2)

Gene

• Entrez ID: 9133
• Gene name: Cyclin B2
• Gene symbol: CCNB2
• Synonyms (NCBI Gene): HsT17299
• Chromosome: 15
• Chromosome location: 15q22.2
• Summary: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052637	hsa-let-7a-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051866	hsa-let-7c-5p	CLASH	23622248
MIRT051400	hsa-let-7f-5p	CLASH	23622248
MIRT046347	hsa-miR-23b-3p	CLASH	23622248
MIRT736557	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	32636645
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	12482752
TP53	Repression	12889596

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	15232106, 17408621, 23455922, 24358021, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0008315	Process	G2/MI transition of meiotic cell cycle	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048538	Process	Thymus development	IEA
GO:0051301	Process	Cell division	IEA

Other IDs

• MIM: 602755
• HGNC: 1580
• e!Ensembl: ENSG00000157456

Protein

• UniProt ID: O95067
• Protein name: G2/mitotic-specific cyclin-B2
• Protein function: Essential for the control of the cell cycle at the G2/M (mitosis) transition.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	137 → 262	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	264 → 382	Cyclin, C-terminal domain	Domain

• Sequence:

  MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
  QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
  DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
  RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
  YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
  VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
  FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS

• Sequence length: 398

Pathways

KEGG:

FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection

Reactome:

Polo-like kinase mediated events
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Initiation of Nuclear Envelope (NE) Reformation
Nuclear Pore Complex (NPC) Disassembly
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
The role of GTSE1 in G2/M progression after G2 checkpoint

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	17289878, 17549666		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	31116002		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	29967001		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961, 32287321, 35185794	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23335992		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	35219767	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26706119		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23282137		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23282137, 32705365, 33285689, 35456460, 36930083, 39206892	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21338529	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12692839		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	31914060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29967001	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29967001	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29728556, 30272310, 30341252, 30720105, 31043166, 31746405, 31811111, 32627011, 32685486, 32722976, 32863381, 33111935, 33157984, 34315286, 34337056, 34603487, 34696748, 35839486, 36317111	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30228980	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26706119		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15331390		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35068444	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30822312, 34716619, 35339898, 38300330	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33477943, 36714024, 37442189	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23704896		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26040697	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32696617, 39528802	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23135747		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30405856, 30995921, 32696617, 34908101, 35774141	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35676807	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26912061		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25748237	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31844417	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29435009, 31043166, 31101236		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15331390		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24375198, 36714024, 39331864	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23282137		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25743799, 30349301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26706119		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16760651, 21161946, 26706119, 31101236		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33032291	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23522059	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35509856, 38166895	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15331390, 18794420, 26349989, 31101236		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26349989		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31278532		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19738611, 31987036	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	19223528		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29233929, 34198380, 34497666, 36834602, 37682152	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27090785		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33217867	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27090785	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34825846	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26912061, 36768994, 36820589	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31612029, 31770041		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12692839, 25743799, 30349301		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25743799, 27983933	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	33455115	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39206892	Stimulate	★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	30816525		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36820589	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35008799	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21338529, 23405241	Associate	★☆☆☆☆ Found in Text Mining only