Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	912
Gene name	CD1d molecule
Gene symbol	CD1D
Synonyms (NCBI Gene)	CD1AR3R3G1
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the pres

204

Show/Hide all (204)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019031	hsa-miR-335-5p	Microarray	18185580
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT528774	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT528773	hsa-miR-3929	PAR-CLIP	22012620
MIRT528772	hsa-miR-4419b	PAR-CLIP	22012620
MIRT528771	hsa-miR-4478	PAR-CLIP	22012620
MIRT528770	hsa-miR-1182	PAR-CLIP	22012620
MIRT528769	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT528768	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT528767	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT528766	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT528765	hsa-miR-4732-5p	PAR-CLIP	22012620
MIRT528764	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT528763	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT528762	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT528761	hsa-miR-3674	PAR-CLIP	22012620
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT528774	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT528773	hsa-miR-3929	PAR-CLIP	22012620
MIRT528772	hsa-miR-4419b	PAR-CLIP	22012620
MIRT528771	hsa-miR-4478	PAR-CLIP	22012620
MIRT528770	hsa-miR-1182	PAR-CLIP	22012620
MIRT528769	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT528768	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT528767	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT528766	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT528765	hsa-miR-4732-5p	PAR-CLIP	22012620
MIRT528764	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT528763	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT528762	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT528761	hsa-miR-3674	PAR-CLIP	22012620
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT874029	hsa-miR-1197	CLIP-seq
MIRT874030	hsa-miR-145	CLIP-seq
MIRT874031	hsa-miR-3652	CLIP-seq
MIRT874032	hsa-miR-378g	CLIP-seq
MIRT874033	hsa-miR-4430	CLIP-seq
MIRT874034	hsa-miR-4505	CLIP-seq
MIRT874035	hsa-miR-4511	CLIP-seq
MIRT874036	hsa-miR-548b-3p	CLIP-seq
MIRT1921945	hsa-miR-377	CLIP-seq
MIRT1921946	hsa-miR-603	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT1959205	hsa-miR-1915	CLIP-seq
MIRT1959206	hsa-miR-2467-5p	CLIP-seq
MIRT1959207	hsa-miR-3188	CLIP-seq
MIRT1959208	hsa-miR-370	CLIP-seq
MIRT1959209	hsa-miR-3975	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT1959211	hsa-miR-4496	CLIP-seq
MIRT1959212	hsa-miR-4649-3p	CLIP-seq
MIRT1959213	hsa-miR-4663	CLIP-seq
MIRT1959214	hsa-miR-4687-3p	CLIP-seq
MIRT1959215	hsa-miR-4726-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT1959217	hsa-miR-485-5p	CLIP-seq
MIRT2196192	hsa-miR-1183	CLIP-seq
MIRT2196193	hsa-miR-1224-3p	CLIP-seq
MIRT2196194	hsa-miR-1260	CLIP-seq
MIRT2196195	hsa-miR-1260b	CLIP-seq
MIRT2196196	hsa-miR-1280	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT2196197	hsa-miR-142-3p	CLIP-seq
MIRT1959205	hsa-miR-1915	CLIP-seq
MIRT2196198	hsa-miR-2117	CLIP-seq
MIRT1959206	hsa-miR-2467-5p	CLIP-seq
MIRT2196199	hsa-miR-3180-5p	CLIP-seq
MIRT1959207	hsa-miR-3188	CLIP-seq
MIRT2196200	hsa-miR-369-3p	CLIP-seq
MIRT1959208	hsa-miR-370	CLIP-seq
MIRT2196201	hsa-miR-374c	CLIP-seq
MIRT1959209	hsa-miR-3975	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT2196202	hsa-miR-4269	CLIP-seq
MIRT2196203	hsa-miR-4273	CLIP-seq
MIRT2196204	hsa-miR-4514	CLIP-seq
MIRT2196205	hsa-miR-4643	CLIP-seq
MIRT1959212	hsa-miR-4649-3p	CLIP-seq
MIRT2196206	hsa-miR-466	CLIP-seq
MIRT1959213	hsa-miR-4663	CLIP-seq
MIRT2196207	hsa-miR-4668-3p	CLIP-seq
MIRT2196208	hsa-miR-4684-5p	CLIP-seq
MIRT1959214	hsa-miR-4687-3p	CLIP-seq
MIRT2196209	hsa-miR-4692	CLIP-seq
MIRT2196210	hsa-miR-4705	CLIP-seq
MIRT2196211	hsa-miR-4713-3p	CLIP-seq
MIRT2196212	hsa-miR-4714-3p	CLIP-seq
MIRT1959215	hsa-miR-4726-3p	CLIP-seq
MIRT2196213	hsa-miR-4742-5p	CLIP-seq
MIRT2196214	hsa-miR-4789-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT1959217	hsa-miR-485-5p	CLIP-seq
MIRT2196215	hsa-miR-520a-5p	CLIP-seq
MIRT2196216	hsa-miR-525-5p	CLIP-seq
MIRT2196217	hsa-miR-532-3p	CLIP-seq
MIRT2196218	hsa-miR-642b	CLIP-seq
MIRT2196219	hsa-miR-655	CLIP-seq
MIRT2196220	hsa-miR-943	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT2196200	hsa-miR-369-3p	CLIP-seq
MIRT2196201	hsa-miR-374c	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT2196205	hsa-miR-4643	CLIP-seq
MIRT2196206	hsa-miR-466	CLIP-seq
MIRT2196214	hsa-miR-4789-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT2196219	hsa-miR-655	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HDAC1	Repression	22419072
HDAC2	Repression	22419072
LEF1	Repression	20363964
LEF1	Unknown	15100293
SP1	Activation	22419072

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	30126976
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	19124746
GO:0005764	Component	Lysosome	IDA	21802320
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	11315191
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	19124746
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016045	Process	Detection of bacterium	TAS	14500461
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030881	Function	Beta-2-microglobulin binding	TAS	14500461
GO:0030882	Function	Lipid antigen binding	IDA	19124746, 21802320
GO:0030883	Function	Endogenous lipid antigen binding	IBA
GO:0030884	Function	Exogenous lipid antigen binding	IBA
GO:0030884	Function	Exogenous lipid antigen binding	IDA	10523605
GO:0034113	Process	Heterotypic cell-cell adhesion	TAS	19124746
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	19124746
GO:0045058	Process	T cell selection	TAS	14500461
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	TAS	14500461
GO:0048006	Process	Antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IBA
GO:0048006	Process	Antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IDA	10523605
GO:0048007	Process	Antigen processing and presentation, exogenous lipid antigen via MHC class Ib	IBA
GO:0050839	Function	Cell adhesion molecule binding	IPI	19124746
GO:0071723	Function	Lipopeptide binding	IBA

MIM	HGNC	e!Ensembl
188410	1637	ENSG00000158473

P15813

Protein name

Antigen-presenting glycoprotein CD1d (R3G1) (CD antigen CD1d)

Protein function

Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

PDB

1ZT4 , 2PO6 , 3HUJ , 3SDX , 3TZV , 3U0P , 3VWJ , 3VWK , 4EN3 , 4LHU , 4MNG , 4MQ7 , 4WO4 , 4WW2 , 4WWK , 6V7Y , 6V7Z , 6V80 , 8SGB , 8SGM , 8SOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16497	MHC_I_3	1 → 198	MHC-I family domain	Domain
PF07654	C1-set	209 → 286	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Sequence

MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	Tight junction Hematopoietic cell lineage Amoebiasis		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (144)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	Pubtator	20592474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23049754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	22253809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	22253809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	BEFREE	22253809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23891738, 25115738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	23171451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	21682789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29346401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28127028, 28363745, 29892305, 30513408, 31540125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	18385757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16540612, 17409322, 29474842, 30210497, 31850305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28127028, 28363745, 29892305, 30513408, 31540125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31191516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10840051, 14719188, 15128771, 18684935, 19651488, 23427253, 25479931, 29191573, 29363187, 29967611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10840051, 15654963, 21853044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	23171451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	32860660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14961579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	23372165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21695190, 28633979, 30711929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21258883, 30651076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15634340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29643189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29872551, 31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33593879, 33761652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25477528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	26339378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17127705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23891738, 25115738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10233754, 21682789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12454749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14961579, 22669567, 23668820, 24418751, 28465341, 28780376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29179729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24717441, 30333822, 31094420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	21548449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	21548449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25477528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20102408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	15051763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	31050367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	19592659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	19592659, 23171451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19637196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	11034419, 19592659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15814708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15814708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11877486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	15128771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15888910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	15128771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	28570692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	24513807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25801352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30322964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32078695	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	15916690, 31214199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	15916690, 35886988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24292792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29108995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	15147365	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	28575142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy cell leukemia variant	Hairy Cell Leukemia	BEFREE	28575142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	23372165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29643189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29643189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17476670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24717441, 31094420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	15864354		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14961579, 31354710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31354710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31354710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19757161, 29643189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11248072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29643189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30319649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30864713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25352488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22406267, 34936686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25352488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25352488, 28338767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25352488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18608348, 27614429, 28258199, 30300581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	27614429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21695190, 28633979, 30711929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21258883, 29872551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29539427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30051730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15030309, 18684935, 19585513, 21258883, 25477528, 27312006, 28193627, 28296542, 28633979, 29163493, 29576533, 29783159, 30013569, 30187578, 30519237, 31560833 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21695190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27614429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23891738, 25115738		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36466837, 38279987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	31050367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	BEFREE	31214199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18980990, 19056691, 38040419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19056691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14734607, 29406905, 31050367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31050367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19056691, 19411762, 21695190, 23891738, 25115738, 25477528, 25479931, 27787577, 28549432, 29163493, 29539427, 29559971, 29872551, 29967611, 30245690, 30651076, 30864713 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18684818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19411762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29872551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31698503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19585513, 28392574, 29509047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19585513, 32184790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	35720369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26023084, 34389782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	23372165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	40280259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23372165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	27424220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	26119195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	11290557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11290557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	10754338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27069116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	19651488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17071498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12360465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29539427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11034419, 19592659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18385757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18385757, 19592659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29179729	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25477528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14719188, 19724888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	19592659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small vessel vasculitis	Small vessel vasculitis	BEFREE	29599785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21980475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30051730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26119195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29706966		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29354122, 29769011, 29783159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31560833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	31560833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31316301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30253046		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	15749842, 19398375		★★★★★ ★☆☆☆☆ Found in Text Mining only

CD1D (CD1d molecule)