Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9112
Gene name	Metastasis associated 1
Gene symbol	MTA1
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q32.33
Summary	This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcin

169

Show/Hide all (169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000033	hsa-miR-661	Review	20026422
MIRT000033	hsa-miR-661	Luciferase reporter assayWestern blot	19584269
MIRT004442	hsa-miR-559	Luciferase reporter assayWestern blot	19584269
MIRT052954	hsa-miR-30c-5p	5.0	22139444
MIRT052954	hsa-miR-30c-5p	5.0	22139444
MIRT052954	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCRWestern blot	22139444
MIRT052954	hsa-miR-30c-5p	qRT-PCRWestern blot	24595016
MIRT052954	hsa-miR-30c-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23988701
MIRT052954	hsa-miR-30c-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23988701
MIRT694397	hsa-miR-3141	HITS-CLIP	23313552
MIRT694396	hsa-miR-4999-3p	HITS-CLIP	23313552
MIRT069482	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT694395	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT694394	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT694393	hsa-miR-1184	HITS-CLIP	23313552
MIRT694392	hsa-miR-1205	HITS-CLIP	23313552
MIRT694391	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT694390	hsa-miR-3616-3p	HITS-CLIP	23313552
MIRT694389	hsa-miR-4721	HITS-CLIP	23313552
MIRT694388	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT694387	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT694386	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT694385	hsa-miR-5194	HITS-CLIP	23313552
MIRT694384	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT694383	hsa-miR-6134	HITS-CLIP	23313552
MIRT694382	hsa-miR-3665	HITS-CLIP	23313552
MIRT694381	hsa-miR-657	HITS-CLIP	23313552
MIRT694380	hsa-miR-3689d	HITS-CLIP	23313552
MIRT694379	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT694378	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT694377	hsa-miR-486-3p	HITS-CLIP	23313552
MIRT694376	hsa-miR-4710	HITS-CLIP	23313552
MIRT694375	hsa-miR-92a-2-5p	HITS-CLIP	23313552
MIRT694374	hsa-miR-3151-5p	HITS-CLIP	23313552
MIRT694373	hsa-miR-3191-5p	HITS-CLIP	23313552
MIRT694372	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT694371	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT694370	hsa-miR-4768-5p	HITS-CLIP	23313552
MIRT694369	hsa-miR-6833-3p	HITS-CLIP	23313552
MIRT694368	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT694367	hsa-miR-1323	HITS-CLIP	23313552
MIRT069484	hsa-miR-543	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26968810
MIRT069484	hsa-miR-543	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26968810
MIRT069482	hsa-miR-125a-3p	Luciferase reporter assayqRT-PCRWestern blot	25998575
MIRT069482	hsa-miR-125a-3p	Luciferase reporter assayqRT-PCRWestern blot	28088556
MIRT694367	hsa-miR-1323	PAR-CLIP	26701625
MIRT694386	hsa-miR-1914-3p	PAR-CLIP	26701625
MIRT694374	hsa-miR-3151-5p	PAR-CLIP	26701625
MIRT694388	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT694387	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT694377	hsa-miR-486-3p	PAR-CLIP	26701625
MIRT694396	hsa-miR-4999-3p	PAR-CLIP	26701625
MIRT694385	hsa-miR-5194	PAR-CLIP	26701625
MIRT694371	hsa-miR-6734-5p	PAR-CLIP	26701625
MIRT694384	hsa-miR-6738-5p	PAR-CLIP	26701625
MIRT694375	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT694397	hsa-miR-3141	HITS-CLIP	23313552
MIRT694396	hsa-miR-4999-3p	HITS-CLIP	23313552
MIRT069482	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT694395	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT694394	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT694393	hsa-miR-1184	HITS-CLIP	23313552
MIRT694392	hsa-miR-1205	HITS-CLIP	23313552
MIRT694391	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT694390	hsa-miR-3616-3p	HITS-CLIP	23313552
MIRT694389	hsa-miR-4721	HITS-CLIP	23313552
MIRT694388	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT694387	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT694386	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT694385	hsa-miR-5194	HITS-CLIP	23313552
MIRT694384	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT694383	hsa-miR-6134	HITS-CLIP	23313552
MIRT694382	hsa-miR-3665	HITS-CLIP	23313552
MIRT694381	hsa-miR-657	HITS-CLIP	23313552
MIRT694380	hsa-miR-3689d	HITS-CLIP	23313552
MIRT694379	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT694378	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT694377	hsa-miR-486-3p	HITS-CLIP	23313552
MIRT694376	hsa-miR-4710	HITS-CLIP	23313552
MIRT694375	hsa-miR-92a-2-5p	HITS-CLIP	23313552
MIRT694374	hsa-miR-3151-5p	HITS-CLIP	23313552
MIRT694373	hsa-miR-3191-5p	HITS-CLIP	23313552
MIRT694372	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT694371	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT694370	hsa-miR-4768-5p	HITS-CLIP	23313552
MIRT694369	hsa-miR-6833-3p	HITS-CLIP	23313552
MIRT694368	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT694367	hsa-miR-1323	HITS-CLIP	23313552
MIRT1162166	hsa-miR-1283	CLIP-seq
MIRT1162167	hsa-miR-199a-5p	CLIP-seq
MIRT1162168	hsa-miR-199b-5p	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162170	hsa-miR-3151	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162172	hsa-miR-361-3p	CLIP-seq
MIRT1162173	hsa-miR-3648	CLIP-seq
MIRT1162174	hsa-miR-3670	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162177	hsa-miR-4669	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2046467	hsa-miR-1296	CLIP-seq
MIRT2046468	hsa-miR-1538	CLIP-seq
MIRT2046469	hsa-miR-2909	CLIP-seq
MIRT2046470	hsa-miR-3065-5p	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT2046471	hsa-miR-421	CLIP-seq
MIRT2046472	hsa-miR-4258	CLIP-seq
MIRT2046473	hsa-miR-4512	CLIP-seq
MIRT2046474	hsa-miR-4514	CLIP-seq
MIRT2046475	hsa-miR-4645-5p	CLIP-seq
MIRT2046476	hsa-miR-4651	CLIP-seq
MIRT2046477	hsa-miR-4660	CLIP-seq
MIRT2046478	hsa-miR-4665-3p	CLIP-seq
MIRT2046479	hsa-miR-4673	CLIP-seq
MIRT2046480	hsa-miR-4688	CLIP-seq
MIRT2046481	hsa-miR-4692	CLIP-seq
MIRT2046482	hsa-miR-4709-5p	CLIP-seq
MIRT2046483	hsa-miR-4745-3p	CLIP-seq
MIRT2046484	hsa-miR-4749-3p	CLIP-seq
MIRT2046485	hsa-miR-4755-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2046486	hsa-miR-564	CLIP-seq
MIRT2046487	hsa-miR-608	CLIP-seq
MIRT2046488	hsa-miR-663b	CLIP-seq
MIRT2275575	hsa-miR-183	CLIP-seq
MIRT1162167	hsa-miR-199a-5p	CLIP-seq
MIRT1162168	hsa-miR-199b-5p	CLIP-seq
MIRT2046470	hsa-miR-3065-5p	CLIP-seq
MIRT2275576	hsa-miR-30a	CLIP-seq
MIRT2275577	hsa-miR-30b	CLIP-seq
MIRT2275578	hsa-miR-30c	CLIP-seq
MIRT2275579	hsa-miR-30d	CLIP-seq
MIRT2275580	hsa-miR-30e	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162172	hsa-miR-361-3p	CLIP-seq
MIRT2275581	hsa-miR-3662	CLIP-seq
MIRT2275582	hsa-miR-3669	CLIP-seq
MIRT2275583	hsa-miR-3917	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT2046471	hsa-miR-421	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162177	hsa-miR-4669	CLIP-seq
MIRT2046482	hsa-miR-4709-5p	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2275584	hsa-miR-548a-5p	CLIP-seq
MIRT2275585	hsa-miR-548ab	CLIP-seq
MIRT2275586	hsa-miR-548ak	CLIP-seq
MIRT2275587	hsa-miR-548b-5p	CLIP-seq
MIRT2275588	hsa-miR-548c-5p	CLIP-seq
MIRT2275589	hsa-miR-548d-5p	CLIP-seq
MIRT2275590	hsa-miR-548h	CLIP-seq
MIRT2275591	hsa-miR-548i	CLIP-seq
MIRT2275592	hsa-miR-548j	CLIP-seq
MIRT2275593	hsa-miR-548n	CLIP-seq
MIRT2275594	hsa-miR-548w	CLIP-seq
MIRT2275595	hsa-miR-548y	CLIP-seq
MIRT2275596	hsa-miR-572	CLIP-seq
MIRT2275597	hsa-miR-766	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
LMO4	Unknown	16288053
SP1	Activation	21555589

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21965678, 24413532
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IMP	21965678
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IMP	21965678
GO:0005515	Function	Protein binding	IPI	16511565, 18451879, 19805145, 20651739, 21258344, 21555589, 21965678, 23752268, 24413532, 24920672, 24970816, 24981860, 25416956, 25609649, 26028330, 26496610, 26949739, 27705803, 29997244, 30327463, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	21965678, 24413532, 24970816, 28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	24970816
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24970816
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	24970816
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IMP	19805145
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	TAS	8083195
GO:0008270	Function	Zinc ion binding	IEA
GO:0010212	Process	Response to ionizing radiation	IBA
GO:0010212	Process	Response to ionizing radiation	IDA	19805145
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	19805145
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	24413532
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0046872	Function	Metal ion binding	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22926524
GO:1902499	Process	Positive regulation of protein autoubiquitination	IDA	19805145
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

MIM	HGNC	e!Ensembl
603526	7410	ENSG00000182979

Q13330

Protein name

Metastasis-associated protein MTA1

Protein function

Transcriptional coregulator which can act as both a transcriptional corepressor and coactivator (PubMed:16617102, PubMed:17671180, PubMed:17922032, PubMed:21965678, PubMed:24413532). Acts as a component of the histone deacetylase NuRD complex wh

PDB

4BKX , 4PBY , 4PBZ , 4PC0 , 5FXY , 5ICN , 6G16 , 6ZRC , 6ZRD , 7AO8 , 7AO9 , 7AOA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01426	BAH	4 → 164	BAH domain	Domain
PF01448	ELM2	167 → 219	ELM2 domain	Family
PF00249	Myb_DNA-binding	285 → 331	Myb-like DNA-binding domain	Domain
PF00320	GATA	393 → 430	GATA zinc finger	Domain
PF17226	MTA_R1	464 → 541	MTA R1 domain	Domain
PF17226	MTA_R1	656 → 695	MTA R1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High expression in brain, liver, kidney, and cardiac muscle, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. Up-regulated in a wide variety

Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALAD
KHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTR
IARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRY
LETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLL
MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYM
ATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED

Sequence length

715

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HDACs deacetylate histones SUMOylation of transcription factors RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (127)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	12650603, 16733204, 17456737, 25688501, 31487842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14735193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30268463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	16733204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	27323185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	16794389		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16831056, 17671172, 17671180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	21448429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	10967548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10206283, 10967548, 11325822, 16511565, 16617102, 18196870, 19116762, 19584269, 20710043, 21595884, 22184113, 22841502, 22864797, 24413532, 26028330 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10206283, 12527756, 15254226, 16511565, 16617102, 16630134, 21595884, 21990379, 22270359, 22644675, 25811737, 28393842, 30642362, 30782165, 35369814, 35534547, 36539038, 40565190 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20010875, 21555589, 23371285, 26689197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	16502410	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	16831056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10206283, 10840944, 12684630, 14613024, 16424981, 18640824, 20935042, 22576802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16831056	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20010875, 25472720, 28861931, 36575438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15474665, 22576802, 26698569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25501238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33059651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	17469181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36689059	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16831056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18719363, 25501238, 28901313		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30631898, 31486481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30631898, 31486481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27323185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21725997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21617866, 27052252, 31811272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12650603, 19198625, 21448429, 22363125, 23371285, 26543080, 27320813, 28740336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19198625, 21448429, 22363125, 23371285, 27320813, 30610787, 34337713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21725997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28203091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	21595884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30659824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30659824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17671172, 17671180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	21555589	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16733204, 22139444, 30979588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24595016, 28656791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	30170442		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	30170442	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25501238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11948399, 16855396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24424621, 28570554, 28739699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28570554, 28739699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10206283, 27035126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	30249557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	30249557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16502410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	16502410	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36689059	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31152708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	30522116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16511565	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30782165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal carcinoid	Intestinal carcinoid	BEFREE	16424981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	30249557	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	37892177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20697987, 22864797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33059651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30979652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12684630, 18264140, 26503703, 27323415, 28288133, 28589145, 28861931, 29042910, 29635894, 29654742, 30118695, 30522116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12684630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28589145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23988701, 24853685, 26698569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10206283, 21448429, 26698569, 27035126, 34182519	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12684630, 26543080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20661085, 25301048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17671172, 17671180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10206283, 10967548, 11325822, 16511565, 16617102, 18196870, 19116762, 19584269, 20710043, 21595884, 22184113, 22841502, 22864797, 24413532, 26028330 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22139444, 30979588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10811997, 28570554, 28739699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15474665, 22576802, 26698569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18719363, 24214543, 25501238, 28901313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10811997, 12650603, 28506766, 28635511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14871807, 19810103, 23227138, 23469203, 25797255, 26214308, 28231399, 29024573, 29465084, 30027683, 30463302, 31281798, 31487842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25793713, 28686969, 29573865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11804687, 12684630, 16703414, 16831056, 16855396, 17456737, 17549610, 17868030, 18640824, 18719363, 19116762, 21555589, 21617866, 22184113, 22203674 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30631898, 31486481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21617866, 27052252, 31811272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16244788, 16617102, 16855396, 18196870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16617102, 17456737, 26036628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27323185		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10967548, 12650603, 17868030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26689197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14871807, 23227138, 29024573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22537306, 32458989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22844865, 23618874, 23941622, 25245523, 28631568, 29125886, 30013189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10206283, 16001161, 16309230, 16424981, 16502410, 16511565, 16617102, 16703414, 16733204, 16794389, 16831056, 17469181, 18264140, 19116762, 19810103 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17456737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11804687, 20661085, 20935042, 22576802, 23343746, 23718732, 23988701, 25998575, 27506865, 28418915, 28443468, 30651530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	11804687		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	23227138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20710043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26797758, 29805531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35642705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18719363, 25501238, 28901313		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18719363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18719363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25501238, 28901313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10811997, 12650603, 28506766, 28635511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14735193, 28635511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	16831056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	16831056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27044752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	27044752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	36010675, 38027039	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	14871807, 19810103, 23227138, 23469203, 25797255, 26214308, 28231399, 29024573, 29465084, 30027683, 30463302, 31281798, 31487842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	31487842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	14871807, 23469203, 29024573, 29465084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14871807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23227138, 23900262, 25797255, 31487842, 37143720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26970310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10206283, 18640824, 31152708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16703414, 24424621, 28739699, 28927077, 31783401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25301048, 34182519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28686969, 29573865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	16502410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25793713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30249557	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	11689291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30314706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30344797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	22022494, 22305334		★★★★★ ★☆☆☆☆ Found in Text Mining only

MTA1 (metastasis associated 1)