Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9111
Gene name	N-myc and STAT interactor
Gene symbol	NMI
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q23.3
Summary	NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and aug

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021243	hsa-miR-146a-5p	Microarray	18057241
MIRT024731	hsa-miR-215-5p	Microarray	19074876
MIRT026633	hsa-miR-192-5p	Microarray	19074876
MIRT2054359	hsa-miR-4699-5p	CLIP-seq
MIRT2054360	hsa-miR-494	CLIP-seq
MIRT2054359	hsa-miR-4699-5p	CLIP-seq
MIRT2054360	hsa-miR-494	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002281	Process	Macrophage activation involved in immune response	IDA	29038465
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	9989503, 10597290, 10779520, 10950963, 16189514, 16214168, 16919237, 20211142, 21516116, 25416956, 26342464, 26871637, 27107012, 28514442, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	29038465
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	9781816, 10950963
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9781816, 10597290, 10950963
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10779520, 10950963
GO:0005829	Component	Cytosol	TAS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	10597290
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	29350881
GO:0009615	Process	Response to virus	IEA
GO:0009615	Process	Response to virus	ISS
GO:0016020	Component	Membrane	IDA	10950963
GO:0032480	Process	Negative regulation of type I interferon production	IEA
GO:0032687	Process	Negative regulation of interferon-alpha production	IEA
GO:0032688	Process	Negative regulation of interferon-beta production	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	ISS
GO:0042802	Function	Identical protein binding	IPI	21516116, 25416956, 32296183
GO:0045087	Process	Innate immune response	IEA
GO:0045088	Process	Regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	ISS
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	IMP	26342464
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IDA	29350881
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	29038465
GO:1902524	Process	Positive regulation of protein K48-linked ubiquitination	IEA

MIM	HGNC	e!Ensembl
603525	7854	ENSG00000123609

Q13287

Protein name

N-myc-interactor (Nmi) (N-myc and STAT interactor)

Protein function

Acts as a signaling pathway regulator involved in innate immune system response (PubMed:26342464, PubMed:29038465, PubMed:29350881, PubMed:9989503). In response to interleukin 2/IL2 and interferon IFN-gamma/IFNG, interacts with signal transducer

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07334	IFP_35_N	29 → 104	Interferon-induced 35 kDa protein (IFP 35) N-terminus	Family
PF07292	NID	105 → 192	Nmi/IFP 35 domain (NID)	Domain
PF07292	NID	203 → 291	Nmi/IFP 35 domain (NID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in adult spleen, liver, and kidney (PubMed:9781816). Expressed in fetal thymus, liver, placenta, spleen, lung, and kidney but not brain (PubMed:9781816). Expressed in macrophages (PubMed:29038465). {ECO:0000269|PubMed:2903846

Sequence

MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQI
KEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVS
MSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELS
FSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTE
IHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQP
HIAYFEE

Sequence length

307

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29025423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26342464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19358268, 25174825, 26146406, 28492540, 29326438, 30859354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15996661, 25174825, 28492540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29025423, 29030066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19240718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31230364		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	30771232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25669971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30356407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25669971, 30356407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25387807, 25669971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25387807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28077802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19358268, 25174825, 26146406, 28492540, 29326438, 30859354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29025423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19240718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29859005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12736119, 26874464, 28492540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11916966, 15996661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25174825		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19358268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19358268, 21072204, 25174825, 25669971, 26874464, 27451077, 28077802, 29025423, 29030066, 29326438, 29737910, 31230364		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19240718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19240718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29038465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29859005		★★★★★ ★☆☆☆☆ Found in Text Mining only

NMI (N-myc and STAT interactor)