Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	91107
Gene name	Tripartite motif containing 47
Gene symbol	TRIM47
Synonyms (NCBI Gene)	GOARNF100
Chromosome	17
Chromosome location	17q25.1

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025905	hsa-miR-7-5p	Microarray	19073608
MIRT1455031	hsa-miR-1254	CLIP-seq
MIRT1455032	hsa-miR-1298	CLIP-seq
MIRT1455033	hsa-miR-1976	CLIP-seq
MIRT1455034	hsa-miR-3065-5p	CLIP-seq
MIRT1455035	hsa-miR-3116	CLIP-seq
MIRT1455036	hsa-miR-3117-5p	CLIP-seq
MIRT1455037	hsa-miR-3153	CLIP-seq
MIRT1455038	hsa-miR-3173-3p	CLIP-seq
MIRT1455039	hsa-miR-3192	CLIP-seq
MIRT1455040	hsa-miR-421	CLIP-seq
MIRT1455041	hsa-miR-4272	CLIP-seq
MIRT1455042	hsa-miR-432	CLIP-seq
MIRT1455043	hsa-miR-4453	CLIP-seq
MIRT1455044	hsa-miR-4461	CLIP-seq
MIRT1455045	hsa-miR-4538	CLIP-seq
MIRT1455046	hsa-miR-4633-3p	CLIP-seq
MIRT1455047	hsa-miR-4646-5p	CLIP-seq
MIRT1455048	hsa-miR-4668-5p	CLIP-seq
MIRT1455049	hsa-miR-4722-3p	CLIP-seq
MIRT1455050	hsa-miR-4747-5p	CLIP-seq
MIRT1455051	hsa-miR-4777-5p	CLIP-seq
MIRT1455052	hsa-miR-4779	CLIP-seq
MIRT1455053	hsa-miR-490-3p	CLIP-seq
MIRT1455054	hsa-miR-518d-5p	CLIP-seq
MIRT1455055	hsa-miR-519b-5p	CLIP-seq
MIRT1455056	hsa-miR-519c-5p	CLIP-seq
MIRT1455057	hsa-miR-520c-5p	CLIP-seq
MIRT1455058	hsa-miR-526a	CLIP-seq
MIRT1455059	hsa-miR-615-5p	CLIP-seq
MIRT1455060	hsa-miR-661	CLIP-seq
MIRT2136365	hsa-miR-1182	CLIP-seq
MIRT2136366	hsa-miR-1184	CLIP-seq
MIRT2136367	hsa-miR-1205	CLIP-seq
MIRT1455031	hsa-miR-1254	CLIP-seq
MIRT2136368	hsa-miR-1343	CLIP-seq
MIRT2136369	hsa-miR-1909	CLIP-seq
MIRT1455033	hsa-miR-1976	CLIP-seq
MIRT1455035	hsa-miR-3116	CLIP-seq
MIRT1455036	hsa-miR-3117-5p	CLIP-seq
MIRT1455037	hsa-miR-3153	CLIP-seq
MIRT2136370	hsa-miR-3158-5p	CLIP-seq
MIRT1455038	hsa-miR-3173-3p	CLIP-seq
MIRT1455039	hsa-miR-3192	CLIP-seq
MIRT2136371	hsa-miR-3690	CLIP-seq
MIRT2136372	hsa-miR-4254	CLIP-seq
MIRT2136373	hsa-miR-4527	CLIP-seq
MIRT1455047	hsa-miR-4646-5p	CLIP-seq
MIRT2136374	hsa-miR-4667-5p	CLIP-seq
MIRT1455048	hsa-miR-4668-5p	CLIP-seq
MIRT2136375	hsa-miR-4700-5p	CLIP-seq
MIRT1455049	hsa-miR-4722-3p	CLIP-seq
MIRT1455051	hsa-miR-4777-5p	CLIP-seq
MIRT1455052	hsa-miR-4779	CLIP-seq
MIRT1455053	hsa-miR-490-3p	CLIP-seq
MIRT2136376	hsa-miR-516a-3p	CLIP-seq
MIRT1455054	hsa-miR-518d-5p	CLIP-seq
MIRT1455055	hsa-miR-519b-5p	CLIP-seq
MIRT1455056	hsa-miR-519c-5p	CLIP-seq
MIRT1455057	hsa-miR-520c-5p	CLIP-seq
MIRT1455058	hsa-miR-526a	CLIP-seq
MIRT1455059	hsa-miR-615-5p	CLIP-seq
MIRT2136377	hsa-miR-637	CLIP-seq
MIRT1455060	hsa-miR-661	CLIP-seq
MIRT1455031	hsa-miR-1254	CLIP-seq
MIRT1455033	hsa-miR-1976	CLIP-seq
MIRT1455035	hsa-miR-3116	CLIP-seq
MIRT1455039	hsa-miR-3192	CLIP-seq
MIRT1455049	hsa-miR-4722-3p	CLIP-seq
MIRT1455050	hsa-miR-4747-5p	CLIP-seq
MIRT1455060	hsa-miR-661	CLIP-seq
MIRT1455037	hsa-miR-3153	CLIP-seq
MIRT1455047	hsa-miR-4646-5p	CLIP-seq
MIRT1455048	hsa-miR-4668-5p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	29291351
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IDA	29291351
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	34110282
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
611041	19020	ENSG00000132481

Q96LD4

Protein name

E3 ubiquitin-protein ligase TRIM47 (EC 2.3.2.27) (Gene overexpressed in astrocytoma protein) (RING finger protein 100) (Tripartite motif-containing protein 47)

Protein function

E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	9 → 57		Domain
PF00643	zf-B_box	177 → 217	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Low expression in most tissues. Higher expression in kidney tubular cells. Overexpressed in astrocytoma tumor cells. {ECO:0000269|PubMed:11511098}.

Sequence

MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGSGPGPAPALAPEPSAPSALPSVPEPSAPCAPEPW
PAGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEES
LCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQSKVLSAVEDRMD
ELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAAALQGFQTQVLGFIEEGEAAMLGRS
QGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPGPGPPRELSFT
KSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLESEAPR
DYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGALDRG
TYYWEVEIIEGWVSMGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPL
PHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSH
FAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR

Sequence length

638

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	34433666	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35617983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31178138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30979374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30979374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31392561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31392561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29291351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33833824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31392561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36474231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30979374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36534449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28186994, 30979374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28186994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31392561		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM47 (tripartite motif containing 47)