Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9099
Gene name	Ubiquitin specific peptidase 2
Gene symbol	USP2
Synonyms (NCBI Gene)	UBP41USP9
Chromosome	11
Chromosome location	11q23.3
Summary	This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nucle

244

Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051401	hsa-let-7f-5p	CLASH	23622248
MIRT037275	hsa-miR-877-5p	CLASH	23622248
MIRT439331	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT439331	hsa-miR-493-5p	HITS-CLIP	24374217
MIRT756384	hsa-miR-1915-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	34599680
MIRT1478308	hsa-miR-15a	CLIP-seq
MIRT1478309	hsa-miR-15b	CLIP-seq
MIRT1478310	hsa-miR-16	CLIP-seq
MIRT1478311	hsa-miR-195	CLIP-seq
MIRT1478312	hsa-miR-24	CLIP-seq
MIRT1478313	hsa-miR-331-3p	CLIP-seq
MIRT1478314	hsa-miR-3925-3p	CLIP-seq
MIRT1478315	hsa-miR-424	CLIP-seq
MIRT1478316	hsa-miR-4254	CLIP-seq
MIRT1478317	hsa-miR-4284	CLIP-seq
MIRT1478318	hsa-miR-4308	CLIP-seq
MIRT1478319	hsa-miR-4524	CLIP-seq
MIRT1478320	hsa-miR-4539	CLIP-seq
MIRT1478321	hsa-miR-4653-3p	CLIP-seq
MIRT1478322	hsa-miR-4709-3p	CLIP-seq
MIRT1478323	hsa-miR-4721	CLIP-seq
MIRT1478324	hsa-miR-497	CLIP-seq
MIRT1478325	hsa-miR-503	CLIP-seq
MIRT1478326	hsa-miR-508-5p	CLIP-seq
MIRT1478327	hsa-miR-622	CLIP-seq
MIRT1478328	hsa-miR-646	CLIP-seq
MIRT1478329	hsa-miR-1321	CLIP-seq
MIRT1478330	hsa-miR-2909	CLIP-seq
MIRT1478331	hsa-miR-3162-5p	CLIP-seq
MIRT1478332	hsa-miR-4282	CLIP-seq
MIRT1478333	hsa-miR-4739	CLIP-seq
MIRT1478334	hsa-miR-4756-5p	CLIP-seq
MIRT1478335	hsa-miR-4781-5p	CLIP-seq
MIRT1478336	hsa-miR-744	CLIP-seq
MIRT2144078	hsa-miR-1915	CLIP-seq
MIRT2144079	hsa-miR-4271	CLIP-seq
MIRT2144080	hsa-miR-4725-3p	CLIP-seq
MIRT1478313	hsa-miR-331-3p	CLIP-seq
MIRT2364278	hsa-miR-3921	CLIP-seq
MIRT2364279	hsa-miR-4653-5p	CLIP-seq
MIRT2657950	hsa-miR-1207-3p	CLIP-seq
MIRT2657951	hsa-miR-1253	CLIP-seq
MIRT2657952	hsa-miR-125a-5p	CLIP-seq
MIRT2657953	hsa-miR-125b	CLIP-seq
MIRT2657954	hsa-miR-1285	CLIP-seq
MIRT2657955	hsa-miR-1286	CLIP-seq
MIRT2657956	hsa-miR-1587	CLIP-seq
MIRT2657957	hsa-miR-1827	CLIP-seq
MIRT2657958	hsa-miR-185	CLIP-seq
MIRT2657959	hsa-miR-1908	CLIP-seq
MIRT2657960	hsa-miR-1912	CLIP-seq
MIRT2144078	hsa-miR-1915	CLIP-seq
MIRT2657961	hsa-miR-205	CLIP-seq
MIRT2657962	hsa-miR-218	CLIP-seq
MIRT1478312	hsa-miR-24	CLIP-seq
MIRT2657963	hsa-miR-2467-5p	CLIP-seq
MIRT2657964	hsa-miR-27a	CLIP-seq
MIRT2657965	hsa-miR-27b	CLIP-seq
MIRT2657966	hsa-miR-2964a-5p	CLIP-seq
MIRT2657967	hsa-miR-30a	CLIP-seq
MIRT2657968	hsa-miR-30b	CLIP-seq
MIRT2657969	hsa-miR-30c	CLIP-seq
MIRT2657970	hsa-miR-30d	CLIP-seq
MIRT2657971	hsa-miR-30e	CLIP-seq
MIRT2657972	hsa-miR-31	CLIP-seq
MIRT2657973	hsa-miR-3123	CLIP-seq
MIRT2657974	hsa-miR-3130-5p	CLIP-seq
MIRT2657975	hsa-miR-3150a-3p	CLIP-seq
MIRT2657976	hsa-miR-3153	CLIP-seq
MIRT2657977	hsa-miR-3154	CLIP-seq
MIRT2657978	hsa-miR-3155	CLIP-seq
MIRT2657979	hsa-miR-3155b	CLIP-seq
MIRT2657980	hsa-miR-3157-3p	CLIP-seq
MIRT2657981	hsa-miR-3160-3p	CLIP-seq
MIRT2657982	hsa-miR-3169	CLIP-seq
MIRT2657983	hsa-miR-3175	CLIP-seq
MIRT2657984	hsa-miR-3177-5p	CLIP-seq
MIRT2657985	hsa-miR-3179	CLIP-seq
MIRT2657986	hsa-miR-3180	CLIP-seq
MIRT2657987	hsa-miR-3180-3p	CLIP-seq
MIRT2657988	hsa-miR-3184	CLIP-seq
MIRT2657989	hsa-miR-3187-5p	CLIP-seq
MIRT2657990	hsa-miR-3189-3p	CLIP-seq
MIRT2657991	hsa-miR-3196	CLIP-seq
MIRT2657992	hsa-miR-324-5p	CLIP-seq
MIRT2657993	hsa-miR-326	CLIP-seq
MIRT2657994	hsa-miR-330-5p	CLIP-seq
MIRT2657995	hsa-miR-362-5p	CLIP-seq
MIRT2657996	hsa-miR-3653	CLIP-seq
MIRT2364278	hsa-miR-3921	CLIP-seq
MIRT2657997	hsa-miR-3941	CLIP-seq
MIRT2657998	hsa-miR-3945	CLIP-seq
MIRT2657999	hsa-miR-423-5p	CLIP-seq
MIRT2658000	hsa-miR-4251	CLIP-seq
MIRT2658001	hsa-miR-4253	CLIP-seq
MIRT2658002	hsa-miR-4266	CLIP-seq
MIRT2658003	hsa-miR-4267	CLIP-seq
MIRT2658004	hsa-miR-4306	CLIP-seq
MIRT2658005	hsa-miR-4319	CLIP-seq
MIRT2658006	hsa-miR-4324	CLIP-seq
MIRT2658007	hsa-miR-4434	CLIP-seq
MIRT2658008	hsa-miR-4436b-3p	CLIP-seq
MIRT2658009	hsa-miR-4437	CLIP-seq
MIRT2658010	hsa-miR-4468	CLIP-seq
MIRT2658011	hsa-miR-4476	CLIP-seq
MIRT2658012	hsa-miR-4482	CLIP-seq
MIRT2658013	hsa-miR-4488	CLIP-seq
MIRT2658014	hsa-miR-4493	CLIP-seq
MIRT2658015	hsa-miR-4512	CLIP-seq
MIRT2658016	hsa-miR-4515	CLIP-seq
MIRT2658017	hsa-miR-4516	CLIP-seq
MIRT2658018	hsa-miR-4531	CLIP-seq
MIRT2658019	hsa-miR-4644	CLIP-seq
MIRT2658020	hsa-miR-4651	CLIP-seq
MIRT2364279	hsa-miR-4653-5p	CLIP-seq
MIRT2658021	hsa-miR-466	CLIP-seq
MIRT2658022	hsa-miR-4672	CLIP-seq
MIRT2658023	hsa-miR-4674	CLIP-seq
MIRT2658024	hsa-miR-4685-5p	CLIP-seq
MIRT2658025	hsa-miR-4695-5p	CLIP-seq
MIRT2658026	hsa-miR-4697-5p	CLIP-seq
MIRT2658027	hsa-miR-4716-3p	CLIP-seq
MIRT2658028	hsa-miR-4726-3p	CLIP-seq
MIRT2658029	hsa-miR-4731-5p	CLIP-seq
MIRT2658030	hsa-miR-4732-3p	CLIP-seq
MIRT2658031	hsa-miR-4738-5p	CLIP-seq
MIRT2658032	hsa-miR-4746-5p	CLIP-seq
MIRT2658033	hsa-miR-4753-5p	CLIP-seq
MIRT2658034	hsa-miR-4779	CLIP-seq
MIRT2658035	hsa-miR-4786-5p	CLIP-seq
MIRT2658036	hsa-miR-484	CLIP-seq
MIRT2658037	hsa-miR-486-3p	CLIP-seq
MIRT2658038	hsa-miR-500b	CLIP-seq
MIRT2658039	hsa-miR-501-5p	CLIP-seq
MIRT2658040	hsa-miR-513a-5p	CLIP-seq
MIRT2658041	hsa-miR-516b	CLIP-seq
MIRT2658042	hsa-miR-539	CLIP-seq
MIRT2658043	hsa-miR-608	CLIP-seq
MIRT2658044	hsa-miR-612	CLIP-seq
MIRT2658045	hsa-miR-625	CLIP-seq
MIRT2658046	hsa-miR-635	CLIP-seq
MIRT2658047	hsa-miR-661	CLIP-seq
MIRT2658048	hsa-miR-663	CLIP-seq
MIRT2658049	hsa-miR-670	CLIP-seq
MIRT2658050	hsa-miR-760	CLIP-seq
MIRT2658051	hsa-miR-766	CLIP-seq
MIRT2658052	hsa-miR-874	CLIP-seq
MIRT2658053	hsa-miR-938	CLIP-seq
MIRT2658054	hsa-miR-939	CLIP-seq
MIRT2658055	hsa-miR-942	CLIP-seq
MIRT2657951	hsa-miR-1253	CLIP-seq
MIRT2657952	hsa-miR-125a-5p	CLIP-seq
MIRT2657953	hsa-miR-125b	CLIP-seq
MIRT2657954	hsa-miR-1285	CLIP-seq
MIRT2657955	hsa-miR-1286	CLIP-seq
MIRT2657956	hsa-miR-1587	CLIP-seq
MIRT2657957	hsa-miR-1827	CLIP-seq
MIRT2657959	hsa-miR-1908	CLIP-seq
MIRT2657960	hsa-miR-1912	CLIP-seq
MIRT2144078	hsa-miR-1915	CLIP-seq
MIRT1478312	hsa-miR-24	CLIP-seq
MIRT2657963	hsa-miR-2467-5p	CLIP-seq
MIRT2657964	hsa-miR-27a	CLIP-seq
MIRT2657965	hsa-miR-27b	CLIP-seq
MIRT2657966	hsa-miR-2964a-5p	CLIP-seq
MIRT2657967	hsa-miR-30a	CLIP-seq
MIRT2657968	hsa-miR-30b	CLIP-seq
MIRT2657969	hsa-miR-30c	CLIP-seq
MIRT2657970	hsa-miR-30d	CLIP-seq
MIRT2657971	hsa-miR-30e	CLIP-seq
MIRT2657972	hsa-miR-31	CLIP-seq
MIRT2657973	hsa-miR-3123	CLIP-seq
MIRT2657974	hsa-miR-3130-5p	CLIP-seq
MIRT2657976	hsa-miR-3153	CLIP-seq
MIRT2657977	hsa-miR-3154	CLIP-seq
MIRT2657978	hsa-miR-3155	CLIP-seq
MIRT2657979	hsa-miR-3155b	CLIP-seq
MIRT2657980	hsa-miR-3157-3p	CLIP-seq
MIRT2657981	hsa-miR-3160-3p	CLIP-seq
MIRT2657982	hsa-miR-3169	CLIP-seq
MIRT2657984	hsa-miR-3177-5p	CLIP-seq
MIRT2657985	hsa-miR-3179	CLIP-seq
MIRT2657986	hsa-miR-3180	CLIP-seq
MIRT2657987	hsa-miR-3180-3p	CLIP-seq
MIRT2657988	hsa-miR-3184	CLIP-seq
MIRT2657989	hsa-miR-3187-5p	CLIP-seq
MIRT2657990	hsa-miR-3189-3p	CLIP-seq
MIRT2657991	hsa-miR-3196	CLIP-seq
MIRT2657992	hsa-miR-324-5p	CLIP-seq
MIRT2657993	hsa-miR-326	CLIP-seq
MIRT2657994	hsa-miR-330-5p	CLIP-seq
MIRT2657996	hsa-miR-3653	CLIP-seq
MIRT2657997	hsa-miR-3941	CLIP-seq
MIRT2657998	hsa-miR-3945	CLIP-seq
MIRT2657999	hsa-miR-423-5p	CLIP-seq
MIRT2658000	hsa-miR-4251	CLIP-seq
MIRT2658001	hsa-miR-4253	CLIP-seq
MIRT2658002	hsa-miR-4266	CLIP-seq
MIRT2658003	hsa-miR-4267	CLIP-seq
MIRT2658005	hsa-miR-4319	CLIP-seq
MIRT2658006	hsa-miR-4324	CLIP-seq
MIRT2658007	hsa-miR-4434	CLIP-seq
MIRT2658008	hsa-miR-4436b-3p	CLIP-seq
MIRT2658009	hsa-miR-4437	CLIP-seq
MIRT2658011	hsa-miR-4476	CLIP-seq
MIRT2658012	hsa-miR-4482	CLIP-seq
MIRT2658013	hsa-miR-4488	CLIP-seq
MIRT2658014	hsa-miR-4493	CLIP-seq
MIRT2658015	hsa-miR-4512	CLIP-seq
MIRT2658016	hsa-miR-4515	CLIP-seq
MIRT2658017	hsa-miR-4516	CLIP-seq
MIRT2658018	hsa-miR-4531	CLIP-seq
MIRT2658020	hsa-miR-4651	CLIP-seq
MIRT2658021	hsa-miR-466	CLIP-seq
MIRT2658022	hsa-miR-4672	CLIP-seq
MIRT2658023	hsa-miR-4674	CLIP-seq
MIRT2658024	hsa-miR-4685-5p	CLIP-seq
MIRT2658025	hsa-miR-4695-5p	CLIP-seq
MIRT2658026	hsa-miR-4697-5p	CLIP-seq
MIRT2658027	hsa-miR-4716-3p	CLIP-seq
MIRT2658028	hsa-miR-4726-3p	CLIP-seq
MIRT2658030	hsa-miR-4732-3p	CLIP-seq
MIRT2658031	hsa-miR-4738-5p	CLIP-seq
MIRT2658032	hsa-miR-4746-5p	CLIP-seq
MIRT2658033	hsa-miR-4753-5p	CLIP-seq
MIRT2658034	hsa-miR-4779	CLIP-seq
MIRT2658035	hsa-miR-4786-5p	CLIP-seq
MIRT2658036	hsa-miR-484	CLIP-seq
MIRT2658037	hsa-miR-486-3p	CLIP-seq
MIRT2658040	hsa-miR-513a-5p	CLIP-seq
MIRT2658041	hsa-miR-516b	CLIP-seq
MIRT2658042	hsa-miR-539	CLIP-seq
MIRT2658043	hsa-miR-608	CLIP-seq
MIRT2658044	hsa-miR-612	CLIP-seq
MIRT2658045	hsa-miR-625	CLIP-seq
MIRT2658046	hsa-miR-635	CLIP-seq
MIRT2658047	hsa-miR-661	CLIP-seq
MIRT2658048	hsa-miR-663	CLIP-seq
MIRT2658049	hsa-miR-670	CLIP-seq
MIRT2658050	hsa-miR-760	CLIP-seq
MIRT2658051	hsa-miR-766	CLIP-seq
MIRT2658052	hsa-miR-874	CLIP-seq
MIRT2658053	hsa-miR-938	CLIP-seq
MIRT2658055	hsa-miR-942	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17290220
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	9827704
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	17290220
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	19917254
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 17290220, 19838211, 22024150, 25416956, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016579	Process	Protein deubiquitination	IDA	19838211, 19917254
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0030332	Function	Cyclin binding	IPI	19917254
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	17290220
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0045475	Process	Locomotor rhythm	IEA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	17290220
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048512	Process	Circadian behavior	IEA
GO:0048512	Process	Circadian behavior	ISS
GO:0050821	Process	Protein stabilization	IDA	17290220
GO:0050821	Process	Protein stabilization	IMP	19838211
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

MIM	HGNC	e!Ensembl
604725	12618	ENSG00000036672

O75604

Protein name

Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.4.19.12) (41 kDa ubiquitin-specific protease) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2)

Protein function

Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1 (PubMed:17290220, PubMed:19838211, PubMed:19917254). Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities (By

PDB

2HD5 , 2IBI , 3NHE , 3V6C , 3V6E , 5XU8 , 5XVE , 6DGF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	267 → 596	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in mesangial cells of the kidney and in different types of glomerulonephritides (at protein level). {ECO:0000269|PubMed:20403044}.

Sequence

MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFL
TRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN
CLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELC
TLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETG
KGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLY
MRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQE
FLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCR
GRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV
YNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELAS
PPSRM

Sequence length

605

Interactions

View interactions

	Reactome
			TNFR1-induced proapoptotic signaling Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Ub-specific processing proteases Regulation of TP53 Degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Facial hypotonia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30869817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27534557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	16227348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21480224, 25687182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25687182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37628997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29501527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27681596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27681596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24005904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	20403044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20090362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36359803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20403044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29501527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29449607	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30869817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21147110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36567903	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20403044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27351221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	27681596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25687182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25888580, 26462181, 28778469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19917254, 27351221, 30918246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25687182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27681596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	20403044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	27351221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21480224, 30918246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29449607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25888580, 26462181, 28778469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15050917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26462181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29449607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27479112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36359803	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35253629, 38062820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	27878758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25687182, 30918246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25687182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP2 (ubiquitin specific peptidase 2)