Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9097
Gene name	Ubiquitin specific peptidase 14
Gene symbol	USP14
Synonyms (NCBI Gene)	TGTUbp6
Chromosome	18
Chromosome location	18p11.32
Summary	This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused prec

540

Show/Hide all (540)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024696	hsa-miR-215-5p	Microarray	19074876
MIRT026381	hsa-miR-192-5p	Microarray	19074876
MIRT029168	hsa-miR-26b-5p	Microarray	19088304
MIRT052527	hsa-let-7a-5p	CLASH	23622248
MIRT052341	hsa-let-7b-5p	CLASH	23622248
MIRT047022	hsa-miR-204-5p	CLASH	23622248
MIRT054443	hsa-miR-4782-3p	Luciferase reporter assayqRT-PCRWestern blot	24556800
MIRT054443	hsa-miR-4782-3p	Luciferase reporter assayqRT-PCRWestern blot	24556800
MIRT665533	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT665532	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT665531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT665530	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT665529	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT665528	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT665527	hsa-miR-891b	HITS-CLIP	23824327
MIRT665526	hsa-miR-4297	HITS-CLIP	23824327
MIRT665525	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT665524	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT665523	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT665522	hsa-miR-7641	HITS-CLIP	23824327
MIRT665521	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT665520	hsa-miR-3689d	HITS-CLIP	23824327
MIRT198488	hsa-miR-3662	PAR-CLIP	21572407
MIRT198490	hsa-miR-548an	PAR-CLIP	21572407
MIRT500158	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT198492	hsa-miR-451b	PAR-CLIP	21572407
MIRT553048	hsa-miR-5187-3p	PAR-CLIP	21572407
MIRT198486	hsa-miR-635	PAR-CLIP	21572407
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	21572407
MIRT198487	hsa-miR-1262	PAR-CLIP	21572407
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	21572407
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	21572407
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	21572407
MIRT198488	hsa-miR-3662	PAR-CLIP	23446348
MIRT198490	hsa-miR-548an	PAR-CLIP	23446348
MIRT198489	hsa-miR-3714	PAR-CLIP	23446348
MIRT500158	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT198492	hsa-miR-451b	PAR-CLIP	23446348
MIRT198486	hsa-miR-635	PAR-CLIP	23446348
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	23446348
MIRT198487	hsa-miR-1262	PAR-CLIP	23446348
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	23446348
MIRT198488	hsa-miR-3662	PAR-CLIP	24398324
MIRT198490	hsa-miR-548an	PAR-CLIP	24398324
MIRT198489	hsa-miR-3714	PAR-CLIP	24398324
MIRT500158	hsa-miR-140-3p	PAR-CLIP	24398324
MIRT198492	hsa-miR-451b	PAR-CLIP	24398324
MIRT198486	hsa-miR-635	PAR-CLIP	24398324
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	24398324
MIRT198487	hsa-miR-1262	PAR-CLIP	24398324
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	24398324
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	24398324
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	24398324
MIRT290201	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT443727	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT290205	hsa-miR-8068	PAR-CLIP	22100165
MIRT443726	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443725	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT054443	hsa-miR-4782-3p	Luciferase reporter assayqRT-PCR	26782643
MIRT054443	hsa-miR-4782-3p	Luciferase reporter assayqRT-PCR	26782643
MIRT665533	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT665532	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT665531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT665530	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT665529	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT665528	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT665527	hsa-miR-891b	HITS-CLIP	23824327
MIRT665526	hsa-miR-4297	HITS-CLIP	23824327
MIRT665525	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT665524	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT665523	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT665522	hsa-miR-7641	HITS-CLIP	23824327
MIRT665521	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT665520	hsa-miR-3689d	HITS-CLIP	23824327
MIRT198488	hsa-miR-3662	PAR-CLIP	21572407
MIRT198490	hsa-miR-548an	PAR-CLIP	21572407
MIRT500158	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT198492	hsa-miR-451b	PAR-CLIP	21572407
MIRT553048	hsa-miR-5187-3p	PAR-CLIP	21572407
MIRT198486	hsa-miR-635	PAR-CLIP	21572407
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	21572407
MIRT198487	hsa-miR-1262	PAR-CLIP	21572407
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	21572407
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	21572407
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	21572407
MIRT198488	hsa-miR-3662	PAR-CLIP	23446348
MIRT198490	hsa-miR-548an	PAR-CLIP	23446348
MIRT198489	hsa-miR-3714	PAR-CLIP	23446348
MIRT500158	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT198492	hsa-miR-451b	PAR-CLIP	23446348
MIRT198486	hsa-miR-635	PAR-CLIP	23446348
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	23446348
MIRT198487	hsa-miR-1262	PAR-CLIP	23446348
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	23446348
MIRT198488	hsa-miR-3662	PAR-CLIP	24398324
MIRT198490	hsa-miR-548an	PAR-CLIP	24398324
MIRT198489	hsa-miR-3714	PAR-CLIP	24398324
MIRT500158	hsa-miR-140-3p	PAR-CLIP	24398324
MIRT198492	hsa-miR-451b	PAR-CLIP	24398324
MIRT198486	hsa-miR-635	PAR-CLIP	24398324
MIRT198494	hsa-miR-6774-5p	PAR-CLIP	24398324
MIRT198487	hsa-miR-1262	PAR-CLIP	24398324
MIRT198491	hsa-miR-4701-3p	PAR-CLIP	24398324
MIRT198493	hsa-miR-6736-5p	PAR-CLIP	24398324
MIRT500157	hsa-miR-6741-5p	PAR-CLIP	24398324
MIRT290201	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT443727	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT290205	hsa-miR-8068	PAR-CLIP	22100165
MIRT443726	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443725	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT1477678	hsa-miR-1293	CLIP-seq
MIRT1477679	hsa-miR-217	CLIP-seq
MIRT1477680	hsa-miR-2392	CLIP-seq
MIRT1477681	hsa-miR-3120-3p	CLIP-seq
MIRT1477682	hsa-miR-323-5p	CLIP-seq
MIRT1477683	hsa-miR-34b	CLIP-seq
MIRT1477684	hsa-miR-34c-3p	CLIP-seq
MIRT1477685	hsa-miR-4282	CLIP-seq
MIRT1477686	hsa-miR-4291	CLIP-seq
MIRT1477687	hsa-miR-4310	CLIP-seq
MIRT1477688	hsa-miR-4483	CLIP-seq
MIRT1477689	hsa-miR-4668-3p	CLIP-seq
MIRT1477690	hsa-miR-4696	CLIP-seq
MIRT1477691	hsa-miR-4766-5p	CLIP-seq
MIRT1477692	hsa-miR-4773	CLIP-seq
MIRT1477693	hsa-miR-4790-3p	CLIP-seq
MIRT1477694	hsa-miR-494	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477697	hsa-miR-520d-5p	CLIP-seq
MIRT1477698	hsa-miR-524-5p	CLIP-seq
MIRT1477699	hsa-miR-545	CLIP-seq
MIRT1477700	hsa-miR-548v	CLIP-seq
MIRT1477701	hsa-miR-556-3p	CLIP-seq
MIRT1477702	hsa-miR-876-3p	CLIP-seq
MIRT1477703	hsa-miR-106a	CLIP-seq
MIRT1477704	hsa-miR-106b	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT1477706	hsa-miR-124	CLIP-seq
MIRT1477707	hsa-miR-1252	CLIP-seq
MIRT1477678	hsa-miR-1293	CLIP-seq
MIRT1477708	hsa-miR-1305	CLIP-seq
MIRT1477709	hsa-miR-141	CLIP-seq
MIRT1477710	hsa-miR-150	CLIP-seq
MIRT1477711	hsa-miR-15a	CLIP-seq
MIRT1477712	hsa-miR-15b	CLIP-seq
MIRT1477713	hsa-miR-16	CLIP-seq
MIRT1477714	hsa-miR-17	CLIP-seq
MIRT1477715	hsa-miR-1825	CLIP-seq
MIRT1477716	hsa-miR-195	CLIP-seq
MIRT1477717	hsa-miR-199a-5p	CLIP-seq
MIRT1477718	hsa-miR-199b-5p	CLIP-seq
MIRT1477719	hsa-miR-200a	CLIP-seq
MIRT1477720	hsa-miR-20a	CLIP-seq
MIRT1477721	hsa-miR-20b	CLIP-seq
MIRT1477679	hsa-miR-217	CLIP-seq
MIRT1477722	hsa-miR-219-5p	CLIP-seq
MIRT1477680	hsa-miR-2392	CLIP-seq
MIRT1477723	hsa-miR-23a	CLIP-seq
MIRT1477724	hsa-miR-23b	CLIP-seq
MIRT1477725	hsa-miR-23c	CLIP-seq
MIRT1477726	hsa-miR-302a	CLIP-seq
MIRT1477727	hsa-miR-302b	CLIP-seq
MIRT1477728	hsa-miR-302c	CLIP-seq
MIRT1477729	hsa-miR-302d	CLIP-seq
MIRT1477730	hsa-miR-302e	CLIP-seq
MIRT1477731	hsa-miR-30a	CLIP-seq
MIRT1477732	hsa-miR-30b	CLIP-seq
MIRT1477733	hsa-miR-30c	CLIP-seq
MIRT1477734	hsa-miR-30d	CLIP-seq
MIRT1477735	hsa-miR-30e	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT1477737	hsa-miR-3183	CLIP-seq
MIRT1477682	hsa-miR-323-5p	CLIP-seq
MIRT1477738	hsa-miR-345	CLIP-seq
MIRT1477739	hsa-miR-3646	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT1477742	hsa-miR-371-5p	CLIP-seq
MIRT1477743	hsa-miR-371b-5p	CLIP-seq
MIRT1477744	hsa-miR-372	CLIP-seq
MIRT1477745	hsa-miR-373	CLIP-seq
MIRT1477746	hsa-miR-377	CLIP-seq
MIRT1477747	hsa-miR-3910	CLIP-seq
MIRT1477748	hsa-miR-3925-3p	CLIP-seq
MIRT1477749	hsa-miR-3929	CLIP-seq
MIRT1477750	hsa-miR-3944-5p	CLIP-seq
MIRT1477751	hsa-miR-424	CLIP-seq
MIRT1477752	hsa-miR-4287	CLIP-seq
MIRT1477686	hsa-miR-4291	CLIP-seq
MIRT1477687	hsa-miR-4310	CLIP-seq
MIRT1477753	hsa-miR-4419b	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT1477755	hsa-miR-4438	CLIP-seq
MIRT1477756	hsa-miR-4445	CLIP-seq
MIRT1477757	hsa-miR-4452	CLIP-seq
MIRT1477758	hsa-miR-4469	CLIP-seq
MIRT1477759	hsa-miR-4478	CLIP-seq
MIRT1477688	hsa-miR-4483	CLIP-seq
MIRT1477760	hsa-miR-4520a-3p	CLIP-seq
MIRT1477761	hsa-miR-4539	CLIP-seq
MIRT1477762	hsa-miR-4638-3p	CLIP-seq
MIRT1477763	hsa-miR-4641	CLIP-seq
MIRT1477764	hsa-miR-4680-3p	CLIP-seq
MIRT1477765	hsa-miR-4685-3p	CLIP-seq
MIRT1477690	hsa-miR-4696	CLIP-seq
MIRT1477766	hsa-miR-4708-3p	CLIP-seq
MIRT1477767	hsa-miR-4712-3p	CLIP-seq
MIRT1477768	hsa-miR-4714-5p	CLIP-seq
MIRT1477769	hsa-miR-4716-5p	CLIP-seq
MIRT1477770	hsa-miR-4723-3p	CLIP-seq
MIRT1477771	hsa-miR-4731-5p	CLIP-seq
MIRT1477772	hsa-miR-4742-5p	CLIP-seq
MIRT1477693	hsa-miR-4790-3p	CLIP-seq
MIRT1477773	hsa-miR-4795-3p	CLIP-seq
MIRT1477774	hsa-miR-488	CLIP-seq
MIRT1477775	hsa-miR-497	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477776	hsa-miR-506	CLIP-seq
MIRT1477777	hsa-miR-508-3p	CLIP-seq
MIRT1477778	hsa-miR-5095	CLIP-seq
MIRT1477779	hsa-miR-5096	CLIP-seq
MIRT1477780	hsa-miR-512-3p	CLIP-seq
MIRT1477781	hsa-miR-513c	CLIP-seq
MIRT1477782	hsa-miR-514b-5p	CLIP-seq
MIRT1477783	hsa-miR-519d	CLIP-seq
MIRT1477784	hsa-miR-520a-3p	CLIP-seq
MIRT1477785	hsa-miR-520b	CLIP-seq
MIRT1477786	hsa-miR-520c-3p	CLIP-seq
MIRT1477787	hsa-miR-520d-3p	CLIP-seq
MIRT1477788	hsa-miR-520e	CLIP-seq
MIRT1477789	hsa-miR-520g	CLIP-seq
MIRT1477790	hsa-miR-520h	CLIP-seq
MIRT1477791	hsa-miR-522	CLIP-seq
MIRT1477792	hsa-miR-548ac	CLIP-seq
MIRT1477793	hsa-miR-548ae	CLIP-seq
MIRT1477794	hsa-miR-548aj	CLIP-seq
MIRT1477795	hsa-miR-548am	CLIP-seq
MIRT1477796	hsa-miR-548d-3p	CLIP-seq
MIRT1477700	hsa-miR-548v	CLIP-seq
MIRT1477797	hsa-miR-548x	CLIP-seq
MIRT1477798	hsa-miR-548z	CLIP-seq
MIRT1477799	hsa-miR-563	CLIP-seq
MIRT1477800	hsa-miR-577	CLIP-seq
MIRT1477801	hsa-miR-587	CLIP-seq
MIRT1477802	hsa-miR-600	CLIP-seq
MIRT1477702	hsa-miR-876-3p	CLIP-seq
MIRT1477803	hsa-miR-93	CLIP-seq
MIRT1555356	hsa-miR-4775	CLIP-seq
MIRT1555357	hsa-miR-590-3p	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT1477723	hsa-miR-23a	CLIP-seq
MIRT1477724	hsa-miR-23b	CLIP-seq
MIRT1477725	hsa-miR-23c	CLIP-seq
MIRT1477731	hsa-miR-30a	CLIP-seq
MIRT1477732	hsa-miR-30b	CLIP-seq
MIRT1477733	hsa-miR-30c	CLIP-seq
MIRT1477734	hsa-miR-30d	CLIP-seq
MIRT1477735	hsa-miR-30e	CLIP-seq
MIRT1477681	hsa-miR-3120-3p	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT2143936	hsa-miR-3157-5p	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT2143937	hsa-miR-3919	CLIP-seq
MIRT1477750	hsa-miR-3944-5p	CLIP-seq
MIRT1477686	hsa-miR-4291	CLIP-seq
MIRT1477687	hsa-miR-4310	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT1477755	hsa-miR-4438	CLIP-seq
MIRT2143938	hsa-miR-4691-3p	CLIP-seq
MIRT2143939	hsa-miR-4704-3p	CLIP-seq
MIRT2143940	hsa-miR-4756-3p	CLIP-seq
MIRT1477692	hsa-miR-4773	CLIP-seq
MIRT1477773	hsa-miR-4795-3p	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477778	hsa-miR-5095	CLIP-seq
MIRT1477779	hsa-miR-5096	CLIP-seq
MIRT1477699	hsa-miR-545	CLIP-seq
MIRT2143941	hsa-miR-548m	CLIP-seq
MIRT2143942	hsa-miR-568	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT2364138	hsa-miR-1224-3p	CLIP-seq
MIRT1477706	hsa-miR-124	CLIP-seq
MIRT2364139	hsa-miR-1260	CLIP-seq
MIRT2364140	hsa-miR-1260b	CLIP-seq
MIRT2364141	hsa-miR-1280	CLIP-seq
MIRT2364142	hsa-miR-1343	CLIP-seq
MIRT1477710	hsa-miR-150	CLIP-seq
MIRT1477711	hsa-miR-15a	CLIP-seq
MIRT1477712	hsa-miR-15b	CLIP-seq
MIRT1477713	hsa-miR-16	CLIP-seq
MIRT1477716	hsa-miR-195	CLIP-seq
MIRT1477681	hsa-miR-3120-3p	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT2364143	hsa-miR-3148	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT2364144	hsa-miR-3653	CLIP-seq
MIRT2364145	hsa-miR-3667-3p	CLIP-seq
MIRT2364146	hsa-miR-3690	CLIP-seq
MIRT2364147	hsa-miR-3692	CLIP-seq
MIRT1477746	hsa-miR-377	CLIP-seq
MIRT1477747	hsa-miR-3910	CLIP-seq
MIRT2364148	hsa-miR-3920	CLIP-seq
MIRT1477750	hsa-miR-3944-5p	CLIP-seq
MIRT1477751	hsa-miR-424	CLIP-seq
MIRT2364149	hsa-miR-4254	CLIP-seq
MIRT2364150	hsa-miR-4255	CLIP-seq
MIRT2364151	hsa-miR-4256	CLIP-seq
MIRT2364152	hsa-miR-4273	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT2364153	hsa-miR-450b-3p	CLIP-seq
MIRT1477760	hsa-miR-4520a-3p	CLIP-seq
MIRT2364154	hsa-miR-4667-3p	CLIP-seq
MIRT2364155	hsa-miR-4677-5p	CLIP-seq
MIRT1477767	hsa-miR-4712-3p	CLIP-seq
MIRT2364156	hsa-miR-4713-3p	CLIP-seq
MIRT2364157	hsa-miR-4713-5p	CLIP-seq
MIRT1477769	hsa-miR-4716-5p	CLIP-seq
MIRT1477692	hsa-miR-4773	CLIP-seq
MIRT1555356	hsa-miR-4775	CLIP-seq
MIRT2364158	hsa-miR-4782-5p	CLIP-seq
MIRT1477774	hsa-miR-488	CLIP-seq
MIRT1477775	hsa-miR-497	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477776	hsa-miR-506	CLIP-seq
MIRT1477779	hsa-miR-5096	CLIP-seq
MIRT2364159	hsa-miR-513a-5p	CLIP-seq
MIRT1477697	hsa-miR-520d-5p	CLIP-seq
MIRT1477698	hsa-miR-524-5p	CLIP-seq
MIRT2364160	hsa-miR-532-3p	CLIP-seq
MIRT1477699	hsa-miR-545	CLIP-seq
MIRT2364161	hsa-miR-548c-3p	CLIP-seq
MIRT1477701	hsa-miR-556-3p	CLIP-seq
MIRT2364162	hsa-miR-562	CLIP-seq
MIRT1477801	hsa-miR-587	CLIP-seq
MIRT1555357	hsa-miR-590-3p	CLIP-seq
MIRT2364163	hsa-miR-638	CLIP-seq
MIRT2364164	hsa-miR-769-3p	CLIP-seq
MIRT2364165	hsa-miR-873	CLIP-seq
MIRT2364166	hsa-miR-875-3p	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT2441605	hsa-miR-4436b-3p	CLIP-seq
MIRT2441606	hsa-miR-4715-3p	CLIP-seq
MIRT2441607	hsa-miR-4761-3p	CLIP-seq
MIRT2463010	hsa-miR-4267	CLIP-seq
MIRT2463011	hsa-miR-767-5p	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT1555356	hsa-miR-4775	CLIP-seq
MIRT1555357	hsa-miR-590-3p	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT2364138	hsa-miR-1224-3p	CLIP-seq
MIRT2657847	hsa-miR-1236	CLIP-seq
MIRT1477706	hsa-miR-124	CLIP-seq
MIRT2364139	hsa-miR-1260	CLIP-seq
MIRT2364140	hsa-miR-1260b	CLIP-seq
MIRT2364141	hsa-miR-1280	CLIP-seq
MIRT1477678	hsa-miR-1293	CLIP-seq
MIRT2364142	hsa-miR-1343	CLIP-seq
MIRT1477710	hsa-miR-150	CLIP-seq
MIRT1477679	hsa-miR-217	CLIP-seq
MIRT1477680	hsa-miR-2392	CLIP-seq
MIRT1477681	hsa-miR-3120-3p	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT2364143	hsa-miR-3148	CLIP-seq
MIRT2657848	hsa-miR-3149	CLIP-seq
MIRT2657849	hsa-miR-3182	CLIP-seq
MIRT1477682	hsa-miR-323-5p	CLIP-seq
MIRT2657850	hsa-miR-3545-5p	CLIP-seq
MIRT2657851	hsa-miR-3607-3p	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT2364145	hsa-miR-3667-3p	CLIP-seq
MIRT2657852	hsa-miR-3686	CLIP-seq
MIRT2364146	hsa-miR-3690	CLIP-seq
MIRT2364147	hsa-miR-3692	CLIP-seq
MIRT2657853	hsa-miR-375	CLIP-seq
MIRT1477746	hsa-miR-377	CLIP-seq
MIRT2657854	hsa-miR-3909	CLIP-seq
MIRT1477747	hsa-miR-3910	CLIP-seq
MIRT1477749	hsa-miR-3929	CLIP-seq
MIRT2657855	hsa-miR-3934	CLIP-seq
MIRT1477750	hsa-miR-3944-5p	CLIP-seq
MIRT2364149	hsa-miR-4254	CLIP-seq
MIRT2463010	hsa-miR-4267	CLIP-seq
MIRT1477686	hsa-miR-4291	CLIP-seq
MIRT1477687	hsa-miR-4310	CLIP-seq
MIRT1477753	hsa-miR-4419b	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT2441605	hsa-miR-4436b-3p	CLIP-seq
MIRT1477755	hsa-miR-4438	CLIP-seq
MIRT1477759	hsa-miR-4478	CLIP-seq
MIRT1477688	hsa-miR-4483	CLIP-seq
MIRT2364153	hsa-miR-450b-3p	CLIP-seq
MIRT2657856	hsa-miR-4514	CLIP-seq
MIRT2657857	hsa-miR-4527	CLIP-seq
MIRT2657858	hsa-miR-4692	CLIP-seq
MIRT2657859	hsa-miR-4694-3p	CLIP-seq
MIRT1477690	hsa-miR-4696	CLIP-seq
MIRT2657860	hsa-miR-4711-3p	CLIP-seq
MIRT1477767	hsa-miR-4712-3p	CLIP-seq
MIRT2364156	hsa-miR-4713-3p	CLIP-seq
MIRT2364157	hsa-miR-4713-5p	CLIP-seq
MIRT2441606	hsa-miR-4715-3p	CLIP-seq
MIRT2657861	hsa-miR-4735-5p	CLIP-seq
MIRT1477772	hsa-miR-4742-5p	CLIP-seq
MIRT2657862	hsa-miR-4753-3p	CLIP-seq
MIRT2441607	hsa-miR-4761-3p	CLIP-seq
MIRT2657863	hsa-miR-4768-5p	CLIP-seq
MIRT1477692	hsa-miR-4773	CLIP-seq
MIRT1555356	hsa-miR-4775	CLIP-seq
MIRT1477693	hsa-miR-4790-3p	CLIP-seq
MIRT1477773	hsa-miR-4795-3p	CLIP-seq
MIRT2657864	hsa-miR-4797-5p	CLIP-seq
MIRT2657865	hsa-miR-4803	CLIP-seq
MIRT1477694	hsa-miR-494	CLIP-seq
MIRT2657866	hsa-miR-495	CLIP-seq
MIRT2657867	hsa-miR-498	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477776	hsa-miR-506	CLIP-seq
MIRT1477778	hsa-miR-5095	CLIP-seq
MIRT2364159	hsa-miR-513a-5p	CLIP-seq
MIRT1477791	hsa-miR-522	CLIP-seq
MIRT2364160	hsa-miR-532-3p	CLIP-seq
MIRT1477699	hsa-miR-545	CLIP-seq
MIRT2143941	hsa-miR-548m	CLIP-seq
MIRT1477700	hsa-miR-548v	CLIP-seq
MIRT2657868	hsa-miR-552	CLIP-seq
MIRT2364162	hsa-miR-562	CLIP-seq
MIRT2143942	hsa-miR-568	CLIP-seq
MIRT1477800	hsa-miR-577	CLIP-seq
MIRT1555357	hsa-miR-590-3p	CLIP-seq
MIRT2657869	hsa-miR-596	CLIP-seq
MIRT2364163	hsa-miR-638	CLIP-seq
MIRT2657870	hsa-miR-759	CLIP-seq
MIRT2463011	hsa-miR-767-5p	CLIP-seq
MIRT2364164	hsa-miR-769-3p	CLIP-seq
MIRT2364165	hsa-miR-873	CLIP-seq
MIRT2364166	hsa-miR-875-3p	CLIP-seq
MIRT1477702	hsa-miR-876-3p	CLIP-seq
MIRT2657871	hsa-miR-885-5p	CLIP-seq
MIRT2657872	hsa-miR-940	CLIP-seq
MIRT2657873	hsa-miR-942	CLIP-seq
MIRT1477705	hsa-miR-122	CLIP-seq
MIRT2364138	hsa-miR-1224-3p	CLIP-seq
MIRT2657847	hsa-miR-1236	CLIP-seq
MIRT1477706	hsa-miR-124	CLIP-seq
MIRT2364139	hsa-miR-1260	CLIP-seq
MIRT2364140	hsa-miR-1260b	CLIP-seq
MIRT2364141	hsa-miR-1280	CLIP-seq
MIRT1477678	hsa-miR-1293	CLIP-seq
MIRT2694793	hsa-miR-129-5p	CLIP-seq
MIRT2364142	hsa-miR-1343	CLIP-seq
MIRT1477710	hsa-miR-150	CLIP-seq
MIRT2694794	hsa-miR-181a	CLIP-seq
MIRT2694795	hsa-miR-181b	CLIP-seq
MIRT2694796	hsa-miR-181c	CLIP-seq
MIRT2694797	hsa-miR-181d	CLIP-seq
MIRT1477679	hsa-miR-217	CLIP-seq
MIRT1477680	hsa-miR-2392	CLIP-seq
MIRT1477681	hsa-miR-3120-3p	CLIP-seq
MIRT1477736	hsa-miR-3135b	CLIP-seq
MIRT2364143	hsa-miR-3148	CLIP-seq
MIRT2657848	hsa-miR-3149	CLIP-seq
MIRT2657849	hsa-miR-3182	CLIP-seq
MIRT1477682	hsa-miR-323-5p	CLIP-seq
MIRT2657850	hsa-miR-3545-5p	CLIP-seq
MIRT2657851	hsa-miR-3607-3p	CLIP-seq
MIRT1477740	hsa-miR-3650	CLIP-seq
MIRT1477741	hsa-miR-3652	CLIP-seq
MIRT2364145	hsa-miR-3667-3p	CLIP-seq
MIRT2657852	hsa-miR-3686	CLIP-seq
MIRT2364146	hsa-miR-3690	CLIP-seq
MIRT2364147	hsa-miR-3692	CLIP-seq
MIRT2657853	hsa-miR-375	CLIP-seq
MIRT1477746	hsa-miR-377	CLIP-seq
MIRT2657854	hsa-miR-3909	CLIP-seq
MIRT1477747	hsa-miR-3910	CLIP-seq
MIRT2657855	hsa-miR-3934	CLIP-seq
MIRT2364149	hsa-miR-4254	CLIP-seq
MIRT2694798	hsa-miR-4262	CLIP-seq
MIRT2463010	hsa-miR-4267	CLIP-seq
MIRT1477686	hsa-miR-4291	CLIP-seq
MIRT1477687	hsa-miR-4310	CLIP-seq
MIRT1477754	hsa-miR-4430	CLIP-seq
MIRT2441605	hsa-miR-4436b-3p	CLIP-seq
MIRT1477688	hsa-miR-4483	CLIP-seq
MIRT2364153	hsa-miR-450b-3p	CLIP-seq
MIRT2657857	hsa-miR-4527	CLIP-seq
MIRT1477690	hsa-miR-4696	CLIP-seq
MIRT1477767	hsa-miR-4712-3p	CLIP-seq
MIRT2364156	hsa-miR-4713-3p	CLIP-seq
MIRT2364157	hsa-miR-4713-5p	CLIP-seq
MIRT2441606	hsa-miR-4715-3p	CLIP-seq
MIRT2657861	hsa-miR-4735-5p	CLIP-seq
MIRT2657862	hsa-miR-4753-3p	CLIP-seq
MIRT2441607	hsa-miR-4761-3p	CLIP-seq
MIRT2657863	hsa-miR-4768-5p	CLIP-seq
MIRT1477692	hsa-miR-4773	CLIP-seq
MIRT1555356	hsa-miR-4775	CLIP-seq
MIRT1477693	hsa-miR-4790-3p	CLIP-seq
MIRT1477773	hsa-miR-4795-3p	CLIP-seq
MIRT2657864	hsa-miR-4797-5p	CLIP-seq
MIRT2657867	hsa-miR-498	CLIP-seq
MIRT1477695	hsa-miR-499-3p	CLIP-seq
MIRT1477696	hsa-miR-499a-3p	CLIP-seq
MIRT1477776	hsa-miR-506	CLIP-seq
MIRT2364159	hsa-miR-513a-5p	CLIP-seq
MIRT2364160	hsa-miR-532-3p	CLIP-seq
MIRT1477699	hsa-miR-545	CLIP-seq
MIRT2143941	hsa-miR-548m	CLIP-seq
MIRT1477700	hsa-miR-548v	CLIP-seq
MIRT2657868	hsa-miR-552	CLIP-seq
MIRT2364162	hsa-miR-562	CLIP-seq
MIRT2143942	hsa-miR-568	CLIP-seq
MIRT1477800	hsa-miR-577	CLIP-seq
MIRT1555357	hsa-miR-590-3p	CLIP-seq
MIRT2364163	hsa-miR-638	CLIP-seq
MIRT2657870	hsa-miR-759	CLIP-seq
MIRT2463011	hsa-miR-767-5p	CLIP-seq
MIRT2364164	hsa-miR-769-3p	CLIP-seq
MIRT2364165	hsa-miR-873	CLIP-seq
MIRT2364166	hsa-miR-875-3p	CLIP-seq
MIRT1477702	hsa-miR-876-3p	CLIP-seq
MIRT2657871	hsa-miR-885-5p	CLIP-seq
MIRT2657873	hsa-miR-942	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	9827704
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	19106094, 23958854
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	IMP	18162577
GO:0005515	Function	Protein binding	IPI	19106094, 19135427
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	27666593
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006954	Process	Inflammatory response	IDA	21914792
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	19106094
GO:0016020	Component	Membrane	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	19106094
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045202	Component	Synapse	IEA
GO:0050920	Process	Regulation of chemotaxis	IMP	19106094
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IMP	18162577
GO:0061578	Function	K63-linked deubiquitinase activity	EXP	26620909
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0071108	Process	Protein K48-linked deubiquitination	IMP	18162577
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099523	Component	Presynaptic cytosol	IEA
GO:0101005	Function	Deubiquitinase activity	IMP	19135427
GO:1904293	Process	Negative regulation of ERAD pathway	IBA
GO:1904293	Process	Negative regulation of ERAD pathway	IMP	19135427
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IMP	19135427

MIM	HGNC	e!Ensembl
607274	12612	ENSG00000101557

P54578

Protein name

Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.4.19.12) (Deubiquitinating enzyme 14) (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14)

Protein function

Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins (PubMed:35145029). Ensures the regeneration of ubiquitin at the proteasome (PubMed:18162577, PubMed:28396413). Is a reversibly asso

PDB

2AYN , 2AYO , 5GJQ , 6IIK , 6IIL , 6IIM , 6IIN , 6LVS , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	105 → 480	Ubiquitin carboxyl-terminal hydrolase	Family

Sequence

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESEQ

Sequence length

494

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Distal arthrogryposis and CNS involvement	Pathogenic	rs2144233064	RCV001823201	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23702845, 30527624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30550885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	20850176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	32471496	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	14559899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26712154, 29326710, 29353883, 29748526, 31126320, 31474315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29353883, 36604147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30296012, 31653087, 36693850, 37401238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11940046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15767331, 23702845, 29702194, 31653087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35906484, 36582601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31322234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28029679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21627382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21627382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30149015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24331409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36693850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30550885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	38469793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31594848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27301795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	BEFREE	15324320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37917013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28509417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	9514049		★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	8397797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30388222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31594848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodysfibrinogenemia	Hypodysfibrinogenemia	BEFREE	28419986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34089575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11828340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22710419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	21627382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31703587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28662510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39408703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24867713, 26397990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10646897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23702845, 31653087, 32632734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33737492	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26712154, 29353883, 29748526, 31126320, 31474315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15767331, 23702845, 29702194, 31653087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31322234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28151478, 31126320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30296012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26938858, 27448976, 28364380, 28509417, 28662510, 29763934, 30296012, 31676235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30149015		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29703842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24319254, 26710889, 31639138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	19658153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14760087, 20740637, 22057347, 23702845, 26397990, 26712154, 26938858, 28509417, 31676235, 8514605		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	24358326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30962318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27542828, 31703099, 34089575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31703099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	24358326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29076578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	19169048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23702845, 26938858, 29702194, 30165348		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31322234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35906484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	11708864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	22576020		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARIETAL FORAMINA	Parietal Foramina	BEFREE	16386935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30388222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	14559899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	10426588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28151478, 31126320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28151478, 29353883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	BEFREE	28419986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	15324320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27629392, 28509417, 31342239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37055579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37986681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30296012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27448976, 30296012, 37401238, 37496999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	27990849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	25691154, 27813535, 27825468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25691154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP14 (ubiquitin specific peptidase 14)