Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9088
Gene name	Protein kinase, membrane associated tyrosine/threonine 1
Gene symbol	PKMYT1
Synonyms (NCBI Gene)	MYT1PPP1R126
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. Th

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016346	hsa-miR-193b-3p	Microarray	20304954
MIRT050725	hsa-miR-18a-5p	CLASH	23622248
MIRT042806	hsa-miR-339-5p	CLASH	23622248
MIRT439958	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439959	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439958	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726928	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726929	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726927	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726926	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439959	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237738	hsa-miR-519a	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT2069887	hsa-miR-4462	CLIP-seq
MIRT2069888	hsa-miR-4514	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT2069889	hsa-miR-4645-5p	CLIP-seq
MIRT2069890	hsa-miR-4673	CLIP-seq
MIRT2069891	hsa-miR-4692	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT2069892	hsa-miR-4755-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT2297238	hsa-miR-3671	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT2069887	hsa-miR-4462	CLIP-seq
MIRT2069888	hsa-miR-4514	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT2069889	hsa-miR-4645-5p	CLIP-seq
MIRT2069890	hsa-miR-4673	CLIP-seq
MIRT2069891	hsa-miR-4692	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT2069892	hsa-miR-4755-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237738	hsa-miR-519a	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT2297239	hsa-miR-607	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	9001210
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	TAS	9001210
GO:0004672	Function	Protein kinase activity	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9001210
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9268380
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10373560, 23397142, 23602568, 25852190, 26496610, 28514442, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	9001210
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	9001210
GO:0005829	Component	Cytosol	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	9001210
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IDA	9268380
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9001210
GO:0016301	Function	Kinase activity	IDA	9268380
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	IBA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110031	Process	Negative regulation of G2/MI transition of meiotic cell cycle	IBA

MIM	HGNC	e!Ensembl
602474	29650	ENSG00000127564

Q99640

Protein name

Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase)

Protein function

Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins (PubMed:10373560, PubMed:10504341, PubMed:9001210, PubMed:9268380). Mediates phosphoryla

PDB

3P1A , 5VCV , 5VCW , 5VCX , 5VCY , 5VCZ , 5VD0 , 5VD1 , 5VD3 , 8D6C , 8D6D , 8D6E , 8D6F , 8WJY , 8ZTX , 8ZU2 , 8ZUD , 8ZUL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	110 → 359	Protein kinase domain	Domain

Sequence

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT

Sequence length

499

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Progesterone-mediated oocyte maturation		Polo-like kinase mediated events Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILE DUCT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	28303373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28303373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	24041656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	31837068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31837068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28335434, 35472078, 38291367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31837068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31837068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31173292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33024069, 34959223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29658598, 31173292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31173292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18546293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26673326, 29291346, 30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26673326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26673326, 29291346, 30312684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Goldenhar Syndrome	Goldenhar Syndrome	ORPHANET_DG	27358179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Goldenhar Syndrome	Goldenhar syndrome	Pubtator	32871052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31837068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31837068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	18341605, 21990140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	LHGDN	12524179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28648520, 31173292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31173292	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31837068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30953699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27452673, 31594837		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	24041656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18341605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	17330875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17330875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32518073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28549617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25672434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25477524, 27876123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25477524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31173292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32944406	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35461324, 40393983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32495859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33852421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	GWASCAT_DG	29029846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective disorder, bipolar type	Schizoaffective Disorder	GWASCAT_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31695486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30953699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24015200, 35114989, 37729973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31837068	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PKMYT1 (protein kinase, membrane associated tyrosine/threonine 1)