IL33 (interleukin 33)

Gene

• Entrez ID: 90865
• Gene name: Interleukin 33
• Gene symbol: IL33
• Synonyms (NCBI Gene): C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript vari

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017750	hsa-miR-335-5p	Microarray	18185580
MIRT736393	hsa-miR-524-3p	Western blotting, Microarray, qRT-PCR	31990904
MIRT756199	hsa-miR-181a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34978772
MIRT1064883	hsa-miR-331-3p	CLIP-seq
MIRT1064884	hsa-miR-3660	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT1064886	hsa-miR-4526	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT1064890	hsa-miR-4732-3p	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq
MIRT2247747	hsa-miR-4282	CLIP-seq
MIRT2451770	hsa-miR-758	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2551235	hsa-miR-105	CLIP-seq
MIRT2551236	hsa-miR-1179	CLIP-seq
MIRT2551237	hsa-miR-1225-5p	CLIP-seq
MIRT2551238	hsa-miR-1237	CLIP-seq
MIRT2551239	hsa-miR-1238	CLIP-seq
MIRT2551240	hsa-miR-1248	CLIP-seq
MIRT2551241	hsa-miR-125a-3p	CLIP-seq
MIRT2551242	hsa-miR-1271	CLIP-seq
MIRT2551243	hsa-miR-1279	CLIP-seq
MIRT2551244	hsa-miR-1282	CLIP-seq
MIRT2551245	hsa-miR-1283	CLIP-seq
MIRT2551246	hsa-miR-134	CLIP-seq
MIRT2551247	hsa-miR-142-5p	CLIP-seq
MIRT2551248	hsa-miR-145	CLIP-seq
MIRT2551249	hsa-miR-154	CLIP-seq
MIRT2551250	hsa-miR-15a	CLIP-seq
MIRT2551251	hsa-miR-15b	CLIP-seq
MIRT2551252	hsa-miR-16	CLIP-seq
MIRT2551253	hsa-miR-182	CLIP-seq
MIRT2551254	hsa-miR-1825	CLIP-seq
MIRT2551255	hsa-miR-186	CLIP-seq
MIRT2551256	hsa-miR-195	CLIP-seq
MIRT2551257	hsa-miR-199a-5p	CLIP-seq
MIRT2551258	hsa-miR-199b-5p	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2551259	hsa-miR-204	CLIP-seq
MIRT2551260	hsa-miR-2053	CLIP-seq
MIRT2551261	hsa-miR-2054	CLIP-seq
MIRT2551262	hsa-miR-211	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2551263	hsa-miR-297	CLIP-seq
MIRT2551264	hsa-miR-3074-3p	CLIP-seq
MIRT2551265	hsa-miR-3118	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT2551266	hsa-miR-3148	CLIP-seq
MIRT2551267	hsa-miR-3149	CLIP-seq
MIRT2551268	hsa-miR-3159	CLIP-seq
MIRT2551269	hsa-miR-3164	CLIP-seq
MIRT2551270	hsa-miR-3174	CLIP-seq
MIRT2551271	hsa-miR-3176	CLIP-seq
MIRT2551272	hsa-miR-3194-3p	CLIP-seq
MIRT2551273	hsa-miR-320e	CLIP-seq
MIRT2551274	hsa-miR-323b-3p	CLIP-seq
MIRT2551275	hsa-miR-330-3p	CLIP-seq
MIRT2551276	hsa-miR-3611	CLIP-seq
MIRT2551277	hsa-miR-361-5p	CLIP-seq
MIRT2551278	hsa-miR-3617	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2551279	hsa-miR-3622a-3p	CLIP-seq
MIRT2551280	hsa-miR-3622b-3p	CLIP-seq
MIRT2551281	hsa-miR-3622b-5p	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT2551282	hsa-miR-3659	CLIP-seq
MIRT2551283	hsa-miR-3662	CLIP-seq
MIRT2551284	hsa-miR-3663-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2551285	hsa-miR-3675-3p	CLIP-seq
MIRT2551286	hsa-miR-3682-5p	CLIP-seq
MIRT2551287	hsa-miR-3688-3p	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT2551288	hsa-miR-3921	CLIP-seq
MIRT2551289	hsa-miR-3922-3p	CLIP-seq
MIRT2551290	hsa-miR-3924	CLIP-seq
MIRT2551291	hsa-miR-3925-3p	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT2551292	hsa-miR-3934	CLIP-seq
MIRT2551293	hsa-miR-3942-3p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT2551294	hsa-miR-409-3p	CLIP-seq
MIRT2551295	hsa-miR-424	CLIP-seq
MIRT2551296	hsa-miR-4253	CLIP-seq
MIRT2551297	hsa-miR-4255	CLIP-seq
MIRT2551298	hsa-miR-4257	CLIP-seq
MIRT2551299	hsa-miR-4259	CLIP-seq
MIRT2247747	hsa-miR-4282	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2551300	hsa-miR-4292	CLIP-seq
MIRT2551301	hsa-miR-4308	CLIP-seq
MIRT2551302	hsa-miR-4311	CLIP-seq
MIRT2551303	hsa-miR-4312	CLIP-seq
MIRT2551304	hsa-miR-4318	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2551305	hsa-miR-4423-5p	CLIP-seq
MIRT2551306	hsa-miR-4432	CLIP-seq
MIRT2551307	hsa-miR-4446-5p	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT2551308	hsa-miR-4490	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT2551309	hsa-miR-4495	CLIP-seq
MIRT2551310	hsa-miR-4517	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2551311	hsa-miR-4524	CLIP-seq
MIRT2551312	hsa-miR-4536	CLIP-seq
MIRT2551313	hsa-miR-4539	CLIP-seq
MIRT2551314	hsa-miR-4639-5p	CLIP-seq
MIRT2551315	hsa-miR-4642	CLIP-seq
MIRT2551316	hsa-miR-4643	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT2551317	hsa-miR-4652-3p	CLIP-seq
MIRT2551318	hsa-miR-4653-5p	CLIP-seq
MIRT2551319	hsa-miR-4658	CLIP-seq
MIRT2551320	hsa-miR-4660	CLIP-seq
MIRT2551321	hsa-miR-4661-5p	CLIP-seq
MIRT2551322	hsa-miR-4670-3p	CLIP-seq
MIRT2551323	hsa-miR-4677-3p	CLIP-seq
MIRT2551324	hsa-miR-4679	CLIP-seq
MIRT2551325	hsa-miR-4682	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT2551326	hsa-miR-4694-5p	CLIP-seq
MIRT2551327	hsa-miR-4699-3p	CLIP-seq
MIRT2551328	hsa-miR-4699-5p	CLIP-seq
MIRT2551329	hsa-miR-4709-3p	CLIP-seq
MIRT2551330	hsa-miR-4715-5p	CLIP-seq
MIRT2551331	hsa-miR-4720-3p	CLIP-seq
MIRT2551332	hsa-miR-4738-3p	CLIP-seq
MIRT2551333	hsa-miR-4753-3p	CLIP-seq
MIRT2551334	hsa-miR-4755-5p	CLIP-seq
MIRT2551335	hsa-miR-4761-3p	CLIP-seq
MIRT2551336	hsa-miR-4774-3p	CLIP-seq
MIRT2551337	hsa-miR-4774-5p	CLIP-seq
MIRT2551338	hsa-miR-4778-3p	CLIP-seq
MIRT2551339	hsa-miR-4778-5p	CLIP-seq
MIRT2551340	hsa-miR-4786-3p	CLIP-seq
MIRT2551341	hsa-miR-4789-5p	CLIP-seq
MIRT2551342	hsa-miR-4797-3p	CLIP-seq
MIRT2551343	hsa-miR-4797-5p	CLIP-seq
MIRT2551344	hsa-miR-4804-3p	CLIP-seq
MIRT2551345	hsa-miR-490-3p	CLIP-seq
MIRT2551346	hsa-miR-494	CLIP-seq
MIRT2551347	hsa-miR-495	CLIP-seq
MIRT2551348	hsa-miR-496	CLIP-seq
MIRT2551349	hsa-miR-497	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT2551350	hsa-miR-503	CLIP-seq
MIRT2551351	hsa-miR-513a-5p	CLIP-seq
MIRT2551352	hsa-miR-515-5p	CLIP-seq
MIRT2551353	hsa-miR-520a-5p	CLIP-seq
MIRT2551354	hsa-miR-525-5p	CLIP-seq
MIRT2551355	hsa-miR-532-5p	CLIP-seq
MIRT2551356	hsa-miR-543	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT2551357	hsa-miR-548k	CLIP-seq
MIRT2551358	hsa-miR-548l	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT2551359	hsa-miR-548t	CLIP-seq
MIRT2551360	hsa-miR-548u	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT2551361	hsa-miR-561	CLIP-seq
MIRT2551362	hsa-miR-569	CLIP-seq
MIRT2551363	hsa-miR-570	CLIP-seq
MIRT2551364	hsa-miR-574-5p	CLIP-seq
MIRT2551365	hsa-miR-576-3p	CLIP-seq
MIRT2551366	hsa-miR-577	CLIP-seq
MIRT2551367	hsa-miR-579	CLIP-seq
MIRT2551368	hsa-miR-582-3p	CLIP-seq
MIRT2551369	hsa-miR-582-5p	CLIP-seq
MIRT2551370	hsa-miR-590-3p	CLIP-seq
MIRT2551371	hsa-miR-593	CLIP-seq
MIRT2551372	hsa-miR-623	CLIP-seq
MIRT2551373	hsa-miR-641	CLIP-seq
MIRT2551374	hsa-miR-643	CLIP-seq
MIRT2551375	hsa-miR-645	CLIP-seq
MIRT2551376	hsa-miR-646	CLIP-seq
MIRT2551377	hsa-miR-654-3p	CLIP-seq
MIRT2551378	hsa-miR-671-5p	CLIP-seq
MIRT2451770	hsa-miR-758	CLIP-seq
MIRT2551379	hsa-miR-760	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2551380	hsa-miR-765	CLIP-seq
MIRT2551381	hsa-miR-766	CLIP-seq
MIRT2551382	hsa-miR-767-3p	CLIP-seq
MIRT2551383	hsa-miR-873	CLIP-seq
MIRT2551384	hsa-miR-888	CLIP-seq
MIRT2551385	hsa-miR-889	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq
MIRT2551386	hsa-miR-96	CLIP-seq
MIRT2551235	hsa-miR-105	CLIP-seq
MIRT2551238	hsa-miR-1237	CLIP-seq
MIRT2551240	hsa-miR-1248	CLIP-seq
MIRT2551245	hsa-miR-1283	CLIP-seq
MIRT2551248	hsa-miR-145	CLIP-seq
MIRT2551249	hsa-miR-154	CLIP-seq
MIRT2551254	hsa-miR-1825	CLIP-seq
MIRT2551255	hsa-miR-186	CLIP-seq
MIRT2551257	hsa-miR-199a-5p	CLIP-seq
MIRT2551258	hsa-miR-199b-5p	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2551260	hsa-miR-2053	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2551264	hsa-miR-3074-3p	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT2551266	hsa-miR-3148	CLIP-seq
MIRT2551268	hsa-miR-3159	CLIP-seq
MIRT2551271	hsa-miR-3176	CLIP-seq
MIRT2551272	hsa-miR-3194-3p	CLIP-seq
MIRT2551274	hsa-miR-323b-3p	CLIP-seq
MIRT2551276	hsa-miR-3611	CLIP-seq
MIRT2551277	hsa-miR-361-5p	CLIP-seq
MIRT2551278	hsa-miR-3617	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2551279	hsa-miR-3622a-3p	CLIP-seq
MIRT2551280	hsa-miR-3622b-3p	CLIP-seq
MIRT2551281	hsa-miR-3622b-5p	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT2551282	hsa-miR-3659	CLIP-seq
MIRT2551283	hsa-miR-3662	CLIP-seq
MIRT2551284	hsa-miR-3663-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2551285	hsa-miR-3675-3p	CLIP-seq
MIRT2551287	hsa-miR-3688-3p	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT2551288	hsa-miR-3921	CLIP-seq
MIRT2551289	hsa-miR-3922-3p	CLIP-seq
MIRT2551291	hsa-miR-3925-3p	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT2551294	hsa-miR-409-3p	CLIP-seq
MIRT2551296	hsa-miR-4253	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2551302	hsa-miR-4311	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2551305	hsa-miR-4423-5p	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT2551308	hsa-miR-4490	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT2551310	hsa-miR-4517	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2551312	hsa-miR-4536	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT2551318	hsa-miR-4653-5p	CLIP-seq
MIRT2551319	hsa-miR-4658	CLIP-seq
MIRT2551321	hsa-miR-4661-5p	CLIP-seq
MIRT2551322	hsa-miR-4670-3p	CLIP-seq
MIRT2551323	hsa-miR-4677-3p	CLIP-seq
MIRT2551324	hsa-miR-4679	CLIP-seq
MIRT2551325	hsa-miR-4682	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT2551326	hsa-miR-4694-5p	CLIP-seq
MIRT2551328	hsa-miR-4699-5p	CLIP-seq
MIRT2551329	hsa-miR-4709-3p	CLIP-seq
MIRT2551332	hsa-miR-4738-3p	CLIP-seq
MIRT2551333	hsa-miR-4753-3p	CLIP-seq
MIRT2551335	hsa-miR-4761-3p	CLIP-seq
MIRT2551336	hsa-miR-4774-3p	CLIP-seq
MIRT2551337	hsa-miR-4774-5p	CLIP-seq
MIRT2551338	hsa-miR-4778-3p	CLIP-seq
MIRT2551339	hsa-miR-4778-5p	CLIP-seq
MIRT2551341	hsa-miR-4789-5p	CLIP-seq
MIRT2551343	hsa-miR-4797-5p	CLIP-seq
MIRT2551345	hsa-miR-490-3p	CLIP-seq
MIRT2551347	hsa-miR-495	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT2551352	hsa-miR-515-5p	CLIP-seq
MIRT2551356	hsa-miR-543	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT2551362	hsa-miR-569	CLIP-seq
MIRT2551363	hsa-miR-570	CLIP-seq
MIRT2551364	hsa-miR-574-5p	CLIP-seq
MIRT2551368	hsa-miR-582-3p	CLIP-seq
MIRT2551370	hsa-miR-590-3p	CLIP-seq
MIRT2551371	hsa-miR-593	CLIP-seq
MIRT2551373	hsa-miR-641	CLIP-seq
MIRT2551374	hsa-miR-643	CLIP-seq
MIRT2551375	hsa-miR-645	CLIP-seq
MIRT2551379	hsa-miR-760	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2551380	hsa-miR-765	CLIP-seq
MIRT2551381	hsa-miR-766	CLIP-seq
MIRT2551382	hsa-miR-767-3p	CLIP-seq
MIRT2551383	hsa-miR-873	CLIP-seq
MIRT2551385	hsa-miR-889	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17185418
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0002112	Function	Interleukin-33 receptor binding	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002282	Process	Microglial cell activation involved in immune response	IEA
GO:0002638	Process	Negative regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002686	Process	Negative regulation of leukocyte migration	IEA
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0002830	Process	Positive regulation of type 2 immune response	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	19841166, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	16286016, 18688256, 29045903
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	27830702
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	18787100, 18836528, 21357533, 22215666
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	22215666
GO:0005737	Component	Cytoplasm	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010186	Process	Positive regulation of cellular defense response	IEA
GO:0010186	Process	Positive regulation of cellular defense response	ISS
GO:0010467	Process	Gene expression	IEA
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	IEA
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0030133	Component	Transport vesicle	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IDA	19841166
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	11960013, 16286016, 17675517, 18802081, 20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IEA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0038172	Process	Interleukin-33-mediated signaling pathway	ISS
GO:0042092	Process	Type 2 immune response	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IDA	19841166
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0045345	Process	Positive regulation of MHC class I biosynthetic process	IEA
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	19841166
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS	19841166
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0061518	Process	Microglial cell proliferation	IEA
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0120042	Process	Negative regulation of macrophage proliferation	IEA
GO:0120042	Process	Negative regulation of macrophage proliferation	ISS
GO:0140367	Process	Antibacterial innate immune response	IEA
GO:0140367	Process	Antibacterial innate immune response	ISS
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373

Other IDs

• MIM: 608678
• HGNC: 16028
• e!Ensembl: ENSG00000137033

Protein

• UniProt ID: O95760
• Protein name: Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)]
• Protein function: Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed:16286016, PubMed:19841166). Involved in the maturation of Th2 cells inducing the secretion
• PDB: 2KLL, 4KC3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15095	IL33	5 → 268	Interleukin 33	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta. {ECO:0000269|PubMed:12819012}.
• Sequence:

  MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
  RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT
  EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK
  MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
  GVKDNHLALIKVDSSENLCTENILFKLSET

• Sequence length: 270

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Necroptosis
Cytosolic DNA-sensing pathway
Influenza A

Reactome:

PIP3 activates AKT signaling
Ub-specific processing proteases
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Interleukin-33 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY, IMMEDIATE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28373582, 31287532		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	23418608		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27120577, 29499051, 30964341		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29499051		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22819319		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25324197, 27120577		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25324197		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	28870670, 30478965		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26755704, 27701734		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19037964, 22233535, 22460070, 26428949, 26489077, 28412624, 28857184, 29790007, 30301503, 30556842, 31043056, 31173279		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	21618506, 23235745, 26748611, 30390302, 30734382		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21368376, 32678011, 36793992, 36835494	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	28675392, 28919759		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	31990904	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	27821781, 30696763, 31087583		★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30544846	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24825247, 27603301		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30426271		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30651000		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	37509127	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18268038, 20543107, 21356240, 25906776, 26571131, 28637660, 29373608, 29793758, 30761089, 30944039, 31043075, 31383884		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18667700, 19913053, 20472598		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	36550815	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34177886, 34816685	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34884710	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19439663, 20070408, 22246057, 23967327, 24106520, 24779919, 26571131, 29363647, 34177886	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26749303	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	21441054		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CTD_human_DG	19198610, 21804549, 24241537, 27472835, 29067999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19439663, 19801525, 20860503, 22694930, 23541324, 24479526, 26119467, 26318341, 26762527, 27177148, 27432971, 27439200, 28176939, 28199345, 28262704, 28682426, 28787443, 29319364, 29453280, 29691411, 29778524, 29957280, 30185520, 30257479, 30303258, 30544846, 31275312, 31437129, 31490928, 32017227, 32817414, 32842623, 33837219, 34928757, 35527008, 35986608, 36366528, 36674744, 37274898	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19801525, 19841166, 20671916, 20689814, 20816195, 20860503, 21618506, 21640974, 21682736, 21804549, 22233535, 22361513, 22562552, 22921786, 23222155, 23380221, 23541324, 23855553, 23945177, 23974679, 24122812, 24568840, 24636086, 25088053, 25091434, 25278425, 25313073, 25617223, 25746970, 26107423, 26119467, 26365875, 26493291, 26748611, 27171815, 27177148, 27310495, 27365223, 27432971, 27699235, 27717665, 28137499, 28176939, 28199345, 28224996, 28252235, 28262704, 28266165, 28273074, 28275176, 28303765, 28410870, 28543931, 28652606, 28658544, 28658558, 28667163, 28787443, 28857185, 28947081, 29084017, 29132961, 29146574, 29221918, 29242144, 29247993, 29253513, 29309756, 29331643, 29402810, 29449864, 29453280, 29455466, 29540770, 29556000, 29581139, 29593738, 29672862, 29691411, 29694974, 29728508, 29778524, 29853649, 29859068, 29908086, 29957280, 29977243, 30127087, 30174671, 30185520, 30191679, 30242072, 30303258, 30385714, 30467418, 30468398, 30544846, 30576068, 30588853, 30734382, 30861490, 30876911, 30914379, 30928652, 30932910, 30941335, 30950351, 30972065, 31057533, 31061143, 31082286, 31112061, 31275312, 31332973, 31392802, 31408015, 31435003, 31455422, 31477395, 31490928, 31566129, 31616416, 31622507, 31703832, 31738991, 31788865, 31820077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	20860503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26107423, 28275176, 31539147, 36685501	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	28787443	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	29785011, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	18268038, 20543107, 21356240, 25906776, 26571131, 28637660, 29373608, 29793758, 30761089, 30944039, 31043075, 31383884		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19439663, 24107076, 24886535, 26571131, 27142573, 29373608, 33669101	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31383884	Inhibit	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	19204726		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	30034292		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20014018, 23028861, 23464866, 25906776, 26164496, 26271893, 26343805, 26566691, 26922618, 27603301, 28041873, 28320438, 28381383, 28423665, 28702024, 28802996, 29175156, 30262031, 30401468, 30819087, 30827881, 30988052, 31085085		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26343805, 27097949, 27579324, 28865413, 33838073, 36550815	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune Nervous System Disorder	BEFREE	29329586		★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	32938972	Stimulate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27821781, 30696763, 31087583		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29963144		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	31391233		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20029461	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23464866, 25119832, 27603301, 29631029, 30447310		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23960440	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33859633	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23178147, 24892809, 31632941, 31764415		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	27142573	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	35617338	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	20532808	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	28389473		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	31142723	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26919112, 27780363, 28216163, 31542504, 31709531		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26456994	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36766731, 37247282, 38003516	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	30159930		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28471975		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	32628310, 33514798	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	36137923, 36685501	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	23794184		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	28176939	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	28176939		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30244258		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35409061	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27619158, 30882917, 31062086		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33062675, 38097352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	35409061	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26775708, 28978138, 29497316, 29499051, 31685439		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26433471	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26926076, 29736154	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29499051	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26433471, 28325363, 30535474, 30899384, 31322193		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	31322193		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	26437894	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	28614418		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19439663, 31316160, 38213254	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21356240, 24075188, 28492698, 29175156, 29982301, 31235844, 31316160, 31660817		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30944039		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	27142573, 28637660	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26343805		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26343805	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24107076	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28389473, 30232272, 31146104		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25106529		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25106529		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25106529		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	28410870, 28985997, 30194239, 31477395		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	29273806		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25580681, 29675965, 30882917		★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	30882917		★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	23178147		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31764415		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	30539029		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	33837219	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28450225		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29784508		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28387719, 28614418, 31726037		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31391233		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26011644		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23945235, 25595648, 28176939, 29123531, 29587772, 29630123, 29859068, 30801682, 30952808, 30973786, 31078066, 31364132, 31392802, 31572551		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27058037, 27992569, 30148445		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	20338108, 24122812, 27870664, 27885166, 29131267, 30259982, 30973971		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	20338108, 24122812, 25692703, 26540312, 27522661, 27885166, 30973971		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	26271893, 29175156, 29922130		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32678011	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	29196629, 32678011	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21099431, 23303670, 25112700, 27921309, 28258042, 28404987, 28423665, 30224451, 30651971, 30696763, 31367158, 31641224		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	23634226	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23634226, 28860510, 31824476, 31918598	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26884875, 27748438, 35798804	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28249897, 28715472, 29463593, 29963144, 31421832		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25324197, 27120577, 27882929, 28710436, 28715472, 29040430, 29329638, 29950152, 30119635, 30547011, 30696763, 31281317		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25324197, 29040430	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	28718914		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23178147, 24892809, 31632941, 31764415		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25580681		★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	30171775		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28381383, 28450225, 28881679, 29325227, 31142723		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29763892		★☆☆☆☆ Found in Text Mining only
Convulsions in the newborn	Convulsions	BEFREE	29311813		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24075188, 25517029, 30123216		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24075188, 25517029, 28045954, 29122645, 30123216		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24075188, 25517029, 28045954, 30123216, 34928757	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26749303	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25517029	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24075188, 25517029, 30123216		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28199345		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17185418, 20405148, 21037074, 23634226, 28533995, 30584414, 30742042		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23634226	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35738281	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29784508		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21441054, 26520876, 29095435, 29867945		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27054346, 29131079		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21674479, 27821781, 28702024, 28751921, 29045819, 30544846, 30735685, 30913451, 31301371		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	30544846	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	26357000	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22272250, 24851948, 31596431, 32044300, 33865911, 34070943, 34293350, 35065132, 35663970	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26107423, 27868148	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	23000728	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	30257479, 33453290	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	29404871		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	22233535, 22272250, 22277940, 22361513, 24122812, 24192701, 24506793, 25906776, 26768665, 27348082, 27372570, 27868148, 28017833, 28224996, 28383552, 28597545, 28656964, 28658558, 28668106, 28684329, 28751921, 28892206, 28952069, 29179209, 29353040, 29368135, 29490771, 29705949, 29748919, 30230040, 30304837, 30846811, 30876911, 30886621, 31121178, 31301371, 31455506, 31514984, 31543211, 31596431, 31645451, 31767859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	22673732, 25739051, 26969580, 28892206, 30684550		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28412870, 28916390, 30498495, 30780005		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31880859	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34235813	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28412870, 28916390, 30498495, 30780005		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34566972	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	27761063	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28045954, 31073344	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35801423, 36368230	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28448894, 30780005		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27726910, 29982301, 30761089, 31073344, 31078923		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	30780005		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31191312, 31535033		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29283120, 31673224	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31673224		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22233535, 22272250, 22277940, 22361513, 24122812, 24192701, 24506793, 25906776, 26768665, 27348082, 27372570, 27868148, 28017833, 28224996, 28383552, 28597545, 28656964, 28658558, 28668106, 28684329, 28751921, 28952069, 29179209, 29242144, 29353040, 29368135, 29490771, 29705949, 29748919, 30230040, 30304837, 30846811, 30876911, 30886621, 31121178, 31301371, 31455506, 31514984, 31543211, 31596431, 31645451, 31767859		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29728120		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	40138919	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASDB_DG	23472165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	GWASCAT_DG	23472165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	25031694	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	25977120, 29263351, 31507610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	19841166, 19860791, 20501612, 23446743, 26200013, 26428949, 26514775, 27056266, 27568595, 28921511, 29282304, 29346348, 29694974, 29859068, 29908086, 30575775, 30576068, 30721149, 31622507		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	20029461, 26047816	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	29859068	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	28754914		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25620273, 26514775, 27233150, 29242581		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29242581	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26433471, 28325363		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39307133	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	40075282	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25003325	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29180837		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	39350187	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19508382, 26018806, 28194023, 28611297, 29180837, 31200771, 31486398, 31632941		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	21703183, 28494352		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	28423364, 29691371		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26986625	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	34996831	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	25409453, 28479485		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31889095	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27050560, 28849217		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28849217, 31889095, 32003751	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28154198		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	27579324	Stimulate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	30863362		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	25814531, 29038366, 30046004, 30694220		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	33527387	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29704819		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	26566691, 30819087		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35065132	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24385685, 31142723, 34342552	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28381383, 28450225, 29325227, 31142723		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	31652497		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	26107423	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	30467800		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31129747		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	31129747		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	31953139	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	35801423	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	37995395	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	26107423	Stimulate	★☆☆☆☆ Found in Text Mining only
Histiocytoid Cardiomyopathy	Histiocytoid Cardiomyopathy	BEFREE	21585276		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	35752781	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	30034292		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30498495		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38255771	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29921553, 30856361, 31235844		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	38255771	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	20029461	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29691411		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37481543	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	24506793		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29896199		★☆☆☆☆ Found in Text Mining only
Idiopathic achalasia of esophagus	Idiopathic achalasia	BEFREE	24468584		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25003325		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23837438, 28202030, 28875265, 31392802		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	25003325		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	31057534		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29068834		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33859633	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	26164496, 29704458		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28448579		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	37972259, 39580416	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	39580416	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20014018, 20405148, 21037074, 21099431, 23071273, 23634226, 23766561, 27921309, 28258042, 28404987, 28687373, 30145369, 30224451, 30405626, 30530480, 31139196, 31294456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23634226, 26884875, 34928757	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	21674479, 27821781, 28702024, 29045819, 30735685, 30913451, 31301371		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24886535, 31073344	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36368230	Stimulate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29784508		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	31165767		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	28710436		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36248807	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29675965		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24107076, 30232272, 31397082, 31660817		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	27659403, 27785924		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	21949094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	27579324	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	28387719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	29070568, 31191312, 31228616		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	29565745		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33324412	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33324412	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30742053, 31652497		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19508382, 21454686, 29656959, 30446569, 31420092		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26095613	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	30478965	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	31953139	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30030493		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	22634619, 28202030, 29499051, 31392802		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29499051, 34928757	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	29319364	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	23837438, 28202030		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29499051, 30452317		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29499051, 34671675	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31103267		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27097949, 28320468, 30984790, 36550815	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31103267		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27449905, 27603301, 28320468, 30148445, 30984790, 31103267		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27603301, 31103267		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31103267		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	31281317		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30515155		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27054346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26919112, 27780363, 28216163, 31542504, 31709531		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30882917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30691509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26775708, 28978138, 29497316, 29499051, 31685439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30535474, 30899384, 31322193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22819319, 28058630, 30535474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21703403, 30696763		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25655003, 25846650, 28000059, 31227713, 31659258		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19082487, 24424522, 25324197, 26922618, 27150562, 27619158, 27640624, 27882929, 28011934, 28119694, 28216163, 28249897, 28325363, 28741710, 29070568, 29463593, 29568370, 29896199, 29963144, 30119635, 30145369, 30256696, 30333314, 30416507, 30426271, 30483263, 30546956, 30619376, 30696763, 30882917, 31396219, 31652497, 31844326		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25106529		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28249897, 28715472, 29463593, 29963144		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26919112		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29490771		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28680750, 30928981		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35669782	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27054346, 29131079		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	24886535	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30761089		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	38255771	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30121258		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30121258	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30199767	Stimulate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	27026387		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Myxomatous 2	Mitral valve prolapse	Pubtator	33669101	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37166618	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	22189043, 28865413, 39294186	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23464866, 28169287, 28865413, 30173119, 30950351, 31770664		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30562364, 36604748	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	30827881		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34928757	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	31238901		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28623858, 34342552	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31039343, 31547872		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28417620		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28041873, 30984196		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19860791, 24122812, 25692703, 26342029, 27522661, 27776277, 27885166, 30259982, 30519393, 31073812		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	20338108, 23805875, 24574111, 26684290, 29768034, 35752781, 36840497	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32085629	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31770211		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31770211	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	20070408, 30935248	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30431380		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30431380		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19082487, 24424522, 25580681, 25655003, 25749030, 25846650, 26775708, 26829987, 26919112, 26922618, 27120577, 27507556, 27619158, 27882929, 28000059, 28119694, 28216163, 28325363, 28680750, 28710436, 28741710, 28978138, 29070568, 29208683, 29440650, 29463593, 29499051, 29675965, 29763370, 29763892, 29950152, 29991126, 30112116, 30119635, 30213787, 30256696, 30275536, 30373846, 30416507, 30446569, 30452317, 30535474, 30546956, 30696763, 30778250, 31062086, 31130612, 31165767, 31227713, 31281317, 31322193, 31421832, 31542504, 31709531, 31717819, 31844326		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29507527		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22246057	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29110391, 30692037		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	29361942, 30654796, 31400073		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28978138, 29568370		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26018806		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29988422		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24886535, 28045954, 31073344, 32101157, 36368230, 38213254	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27472835, 28045954, 28274612, 29161088, 29982301, 30656387, 30856361, 31073344, 31507607		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	27785924		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35565085	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21515798, 30011081		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30846811		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29210060, 29797504, 30854122		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29210060, 32312946	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34247803	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28325363, 30535474, 30899384, 31322193		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26433471	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29784508		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22819319, 28058630, 30535474		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30426271		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35658010	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	23418608, 28373582		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35738281	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19996325, 22819319		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29916143		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38485911	Inhibit	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	25129514, 27111066		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	31491552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periapical Periodontitis	Periapical periodontitis	Pubtator	31218936	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27363844		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27992569, 28320468, 28861078		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	28320468, 36947565	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	31659258	Stimulate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31238901, 31429014		★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	28875265, 29908086		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30296742		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	31608786		★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	40138919	Inhibit	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29784508		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	31596431, 36272417	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21674479, 28836690, 29757591, 30574739, 31427775, 31736655		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34816685	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34884710, 35663970	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29757591		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29988422		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25595648, 29859068	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28176939, 29319364, 31364132, 32017227, 32842623, 33292049, 33486314, 33722239, 33837219, 34354706, 37442582	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	26437894	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30801682		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	22634619, 28875265, 30303258, 30516548, 30928652, 31798831		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27878685, 29417309, 29722022, 31049028, 31106564		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35238669	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	30171775		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29763892		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28668506, 31173201		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30778348, 31057533		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28806218, 31147742, 31360218		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33837219, 36036806	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	35334213	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	31796062		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	30914019		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17185418, 18667700, 20472598, 21431944, 21441054, 22246057, 23464866, 23967327, 24779919, 26520876, 26571131, 27603301, 27659403, 28365573, 28415811, 28802996, 29363647, 29705949, 29798971, 29884223, 30574739, 30846811, 30944039		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	28787443, 34653730, 35035826	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	28787443	Inhibit	★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29921553		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	24768588	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28202030, 28875265, 30195819		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29896199		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	29896199	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28126482, 29988422		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27579324, 31953139	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28374774, 28793286, 29511181, 29610934, 29672927, 29935165, 30001716, 30192340, 30207217, 31507598		★☆☆☆☆ Found in Text Mining only
Simple Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	28875265		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	24122812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27097949	Associate	★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	34293350	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22673732, 24851948, 26357000, 30684550, 33865911	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	21674479, 23464866, 27348082, 27372570, 28365573, 28684329, 28889151, 29631029		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28960823, 31057533		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27659403		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34928757	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21703403, 29208683, 30112116, 30559604		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30559604, 31062086		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29499051		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30357458		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30112116		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	25591771		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28611297, 29180837		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29896199		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25655003, 25846650, 28000059, 31227713, 31659258		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	31320834	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24741632, 31659258	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27074834, 28000059, 33760194, 34071419, 34895039	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30102896		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25678090, 26743213, 30498500, 31498062, 31572353		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	25857925		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27142573, 33669101	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28960823		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19913053, 20405148, 21037074, 21613987, 23634226, 25112700, 27748438, 29329638, 31516554, 31641224, 31824476		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	31837215		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	18827826		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28614418	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	25003325, 31316160, 31947646	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	29908086		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	32286393, 34373564	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28826280		★☆☆☆☆ Found in Text Mining only