SPSB3 (splA/ryanodine receptor domain and SOCS box containing 3)

Gene

• Entrez ID: 90864
• Gene name: SplA/ryanodine receptor domain and SOCS box containing 3
• Gene symbol: SPSB3
• Synonyms (NCBI Gene): C16orf31, SSB3
• Chromosome: 16
• Chromosome location: 16p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2115698	hsa-miR-137	CLIP-seq
MIRT2115699	hsa-miR-25	CLIP-seq
MIRT2115700	hsa-miR-32	CLIP-seq
MIRT2115701	hsa-miR-363	CLIP-seq
MIRT2115702	hsa-miR-367	CLIP-seq
MIRT2115703	hsa-miR-92a	CLIP-seq
MIRT2115704	hsa-miR-92b	CLIP-seq
MIRT2338343	hsa-miR-2277-3p	CLIP-seq
MIRT2338344	hsa-miR-3660	CLIP-seq
MIRT2338345	hsa-miR-4526	CLIP-seq
MIRT2631915	hsa-miR-1258	CLIP-seq
MIRT2631916	hsa-miR-1291	CLIP-seq
MIRT2631917	hsa-miR-146b-3p	CLIP-seq
MIRT2631918	hsa-miR-3148	CLIP-seq
MIRT2631919	hsa-miR-4496	CLIP-seq
MIRT2631920	hsa-miR-4648	CLIP-seq
MIRT2631921	hsa-miR-4654	CLIP-seq
MIRT2631922	hsa-miR-4769-5p	CLIP-seq
MIRT2631923	hsa-miR-548ac	CLIP-seq
MIRT2631924	hsa-miR-548d-3p	CLIP-seq
MIRT2631925	hsa-miR-548z	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	38418882
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	29059170
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	29059170, 38418882
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	34518685
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29059170, 38418882
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	38418882
GO:0140896	Process	CGAS/STING signaling pathway	IDA	30842659, 30842662, 32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	38418882
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	29059170, 38418882
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA

Other IDs

• MIM: 611659
• HGNC: 30629
• e!Ensembl: ENSG00000162032

Protein

• UniProt ID: Q6PJ21
• Protein name: SPRY domain-containing SOCS box protein 3 (SSB-3)
• Protein function: Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as CGAS and SNAI1 (P
• PDB: 8OKX, 8OL1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00622	SPRY	148 → 270	SPRY domain	Family

• Sequence:

  MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIP
  SAVPVTGESFCDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSC
  DNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRH
  TFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCI
  GVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLP
  LPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT

• Sequence length: 355

Pathways

Reactome:

Neddylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OCULAR HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29182684	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29059170		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29059170		★☆☆☆☆ Found in Text Mining only